• Gene id: 2028

Gene Summary

• Gene Symbol: ENPEP   Gene   UCSC   Ensembl
• Aliases: APA, CD249, gp160
• Gene name: glutamyl aminopeptidase
• Alternate names: glutamyl aminopeptidase, AP-A, EAP, aminopeptidase A, differentiation antigen gp160,
• Gene location: 4q25 (110476154: 110565284)     Exons: 20     NC_000004.12
• Gene summary(Entrez): The ENPEP gene encodes glutamyl aminopeptidase, a type II integral membrane protein with an extracellular zinc-binding domain. This protein can upregulate blood pressure by cleaving the N-terminal aspartate from angiotensin II, and can regulate blood vess
• OMIM: 613900

Protein Summary

• Protein general information: Q07075  
  • Name: Glutamyl aminopeptidase (EAP) (EC 3.4.11.7) (Aminopeptidase A) (AP A) (Differentiation antigen gp160) (CD antigen CD249)
  • Length: 957  
  • Mass: 109244
  • Tissue specificity: Expressed in choriocarcinoma cancer cell lines (at protein level) (PubMed
• Sequence:

  MNFAEREGSKRYCIQTKHVAILCAVVVGVGLIVGLAVGLTRSCDSSGDGGPGTAPAPSHLPSSTASPSGPPAQDQ
  DICPASEDESGQWKNFRLPDFVNPVHYDLHVKPLLEEDTYTGTVSISINLSAPTRYLWLHLRETRITRLPELKRP
  SGDQVQVRRCFEYKKQEYVVVEAEEELTPSSGDGLYLLTMEFAGWLNGSLVGFYRTTYTENGQVKSIVATDHEPT
  DARKSFPCFDEPNKKATYTISITHPKEYGALSNMPVAKEESVDDKWTRTTFEKSVPMSTYLVCFAVHQFDSVKRI
  SNSGKPLTIYVQPEQKHTAEYAANITKSVFDYFEEYFAMNYSLPKLDKIAIPDFGTGAMENWGLITYRETNLLYD
  PKESASSNQQRVATVVAHELVHQWFGNIVTMDWWEDLWLNEGFASFFEFLGVNHAETDWQMRDQMLLEDVLPVQE
  DDSLMSSHPIIVTVTTPDEITSVFDGISYSKGSSILRMLEDWIKPENFQKGCQMYLEKYQFKNAKTSDFWAALEE
  ASRLPVKEVMDTWTRQMGYPVLNVNGVKNITQKRFLLDPRANPSQPPSDLGYTWNIPVKWTEDNITSSVLFNRSE
  KEGITLNSSNPSGNAFLKINPDHIGFYRVNYEVATWDSIATALSLNHKTFSSADRASLIDDAFALARAQLLDYKV
  ALNLTKYLKREENFLPWQRVISAVTYIISMFEDDKELYPMIEEYFQGQVKPIADSLGWNDAGDHVTKLLRSSVLG
  FACKMGDREALNNASSLFEQWLNGTVSLPVNLRLLVYRYGMQNSGNEISWNYTLEQYQKTSLAQEKEKLLYGLAS
  VKNVTLLSRYLDLLKDTNLIKTQDVFTVIRYISYNSYGKNMAWNWIQLNWDYLVNRYTLNNRNLGRIVTIAEPFN
  TELQLWQMESFFAKYPQAGAGEKPREQVLETVKNNIEWLKQHRNTIREWFFNLLESG

• Structural information:
  • Interpro: IPR033508  IPR042097  IPR024571  IPR034016  IPR001930   IPR014782  
  • Prosite: PS00142
  • CDD: cd09601
  • PDB: 4KX7 4KX8 4KX9 4KXA 4KXB 4KXC 4KXD
  • PDBsum: 4KX7 4KX8 4KX9 4KXA 4KXB 4KXC 4KXD
  • STRING: ENSP00000265162
• Other Databases: GeneCards:  ENPEP  Malacards:  ENPEP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070006	metalloaminopeptidase activity	IBA	molecular function
GO:0008270	zinc ion binding	IBA	molecular function
GO:0006508	proteolysis	IBA	biological process
GO:0043171	peptide catabolic process	IBA	biological process
GO:0042277	peptide binding	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0070006	metalloaminopeptidase activity	IDA	molecular function
GO:0004177	aminopeptidase activity	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0070006	metalloaminopeptidase activity	IEA	molecular function
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0004177	aminopeptidase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016477	cell migration	IDA	biological process
GO:0008283	cell population proliferation	IDA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0002003	angiotensin maturation	TAS	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0032835	glomerulus development	IEA	biological process
GO:0045177	apical part of cell	IEA	cellular component
GO:0005903	brush border	IEA	cellular component
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0070006	metalloaminopeptidase activity	IDA	molecular function
GO:0004177	aminopeptidase activity	IDA	molecular function
GO:0003081	regulation of systemic arterial blood pressure by renin-angiotensin	IDA	biological process
GO:0070006	metalloaminopeptidase activity	NAS	molecular function
GO:0032835	glomerulus development	ISS	biological process
GO:0002003	angiotensin maturation	NAS	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0016324	apical plasma membrane	ISS	cellular component
GO:0009897	external side of plasma membrane	ISS	cellular component
GO:0005887	integral component of plasma membrane	NAS	cellular component
GO:0045177	apical part of cell	ISS	cellular component
GO:0031410	cytoplasmic vesicle	ISS	cellular component
GO:0007267	cell-cell signaling	NAS	biological process
GO:0005765	lysosomal membrane	HDA	cellular component
GO:0001525	angiogenesis	ISS	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005903	brush border	ISS	cellular component
GO:0003081	regulation of systemic arterial blood pressure by renin-angiotensin	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04614	Renin-angiotensin system

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881