• Gene id: 2023

Gene Summary

• Gene Symbol: ENO1   Gene   UCSC   Ensembl
• Aliases: ENO1L1, HEL-S-17, MPB1, NNE, PPH
• Gene name: enolase 1
• Alternate names: alpha-enolase, c-myc promoter-binding protein-1, 2-phospho-D-glycerate hydro-lyase, MYC promoter-binding protein 1, alpha enolase like 1, enolase 1, (alpha), enolase-alpha, epididymis secretory protein Li 17, non-neural enolase, phosphopyruvate hydratase,,
• Gene location: 1p36.23 (8878685: 8861001)     Exons: 13     NC_000001.11
• Gene summary(Entrez): This gene encodes alpha-enolase, one of three enolase isoenzymes found in mammals. Each isoenzyme is a homodimer composed of 2 alpha, 2 gamma, or 2 beta subunits, and functions as a glycolytic enzyme. Alpha-enolase in addition, functions as a structural l
• OMIM: 172430

Protein Summary

• Protein general information: P06733  
  • Name: Alpha enolase (EC 4.2.1.11) (2 phospho D glycerate hydro lyase) (C myc promoter binding protein) (Enolase 1) (MBP 1) (MPB 1) (Non neural enolase) (NNE) (Phosphopyruvate hydratase) (Plasminogen binding protein)
  • Length: 434  
  • Mass: 47,169
• Sequence:

  MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELRDNDKTRYMGKGVSKAVEHINKTIAP
  ALVSKKLNVTEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCKAGAVEKGVPLYRHIADLAGNSEVILPVPAF
  NVINGGSHAGNKLAMQEFMILPVGAANFREAMRIGAEVYHNLKNVIKEKYGKDATNVGDEGGFAPNILENKEGLE
  LLKTAIGKAGYTDKVVIGMDVAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIKDYPVVSIEDPFDQDD
  WGAWQKFTASAGIQVVGDDLTVTNPKRIAKAVNEKSCNCLLLKVNQIGSVTESLQACKLAQANGWGVMVSHRSGE
  TEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGRNFRNPLAK

• Structural information:
  • Interpro: IPR000941  IPR036849  IPR029017  IPR034390  IPR020810   IPR020809  IPR020811  
  • Prosite: PS00164
  • CDD: cd03313
  • PDB: 2PSN 3B97 5JLZ 5LAX
  • PDBsum: 2PSN 3B97 5JLZ 5LAX
  • STRING: ENSP00000234590
• Other Databases: GeneCards:  ENO1  Malacards:  ENO1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000015	phosphopyruvate hydratase complex	IEA	cellular component
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	TAS	biological process
GO:0000287	magnesium ion binding	IEA	molecular function
GO:0001701	in utero embryonic development	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	TAS	molecular function
GO:0003714	transcription corepressor activity	TAS	molecular function
GO:0004634	phosphopyruvate hydratase activity	TAS	molecular function
GO:0004634	phosphopyruvate hydratase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005634	nucleus	IC	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006094	gluconeogenesis	TAS	biological process
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0009615	response to virus	IEP	biological process
GO:0016020	membrane	IDA	cellular component
GO:0019897	extrinsic component of plasma membrane	IEA	cellular component
GO:0030308	negative regulation of cell growth	IDA	biological process
GO:0031430	M band	IEA	cellular component
GO:0043209	myelin sheath	IEA	cellular component
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IMP	biological process
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0051020	GTPase binding	IPI	molecular function
GO:0051099	positive regulation of binding	IEA	biological process
GO:0061621	canonical glycolysis	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0000015	phosphopyruvate hydratase complex	IEA	cellular component
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	TAS	biological process
GO:0000287	magnesium ion binding	IEA	molecular function
GO:0001701	in utero embryonic development	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	TAS	molecular function
GO:0003714	transcription corepressor activity	TAS	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0004634	phosphopyruvate hydratase activity	IEA	molecular function
GO:0004634	phosphopyruvate hydratase activity	IEA	molecular function
GO:0004634	phosphopyruvate hydratase activity	IEA	molecular function
GO:0004634	phosphopyruvate hydratase activity	TAS	molecular function
GO:0004634	phosphopyruvate hydratase activity	TAS	molecular function
GO:0004634	phosphopyruvate hydratase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IC	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006094	gluconeogenesis	TAS	biological process
GO:0006096	glycolytic process	IEA	biological process
GO:0006096	glycolytic process	IEA	biological process
GO:0006096	glycolytic process	IEA	biological process
GO:0006096	glycolytic process	IEA	biological process
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0009615	response to virus	IEP	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0016829	lyase activity	IEA	molecular function
GO:0019897	extrinsic component of plasma membrane	IEA	cellular component
GO:0030308	negative regulation of cell growth	IDA	biological process
GO:0031430	M band	IEA	cellular component
GO:0043209	myelin sheath	IEA	cellular component
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IMP	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0051020	GTPase binding	IPI	molecular function
GO:0051099	positive regulation of binding	IEA	biological process
GO:0061621	canonical glycolysis	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	TAS	biological process
GO:0003700	transcription factor activity, sequence-specific DNA binding	TAS	molecular function
GO:0003714	transcription corepressor activity	TAS	molecular function
GO:0004634	phosphopyruvate hydratase activity	TAS	molecular function
GO:0004634	phosphopyruvate hydratase activity	TAS	molecular function
GO:0004634	phosphopyruvate hydratase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005634	nucleus	IC	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006094	gluconeogenesis	TAS	biological process
GO:0009615	response to virus	IEP	biological process
GO:0016020	membrane	IDA	cellular component
GO:0030308	negative regulation of cell growth	IDA	biological process
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IMP	biological process
GO:0051020	GTPase binding	IPI	molecular function
GO:0061621	canonical glycolysis	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa01200	Carbon metabolism
hsa01230	Biosynthesis of amino acids
hsa00010	Glycolysis / Gluconeogenesis
hsa04066	HIF-1 signaling pathway

Diseases

Associated diseases	References
Myocardial Infarction	GAD: 18682748
Cardiovascular disease	GAD: 18682748
Enolase deficiency	OMIM: 172430
Endometriosis	INFBASE: 24283984
Female infertility	INFBASE: 24283984
Premature ovarian failure (POF)	INFBASE: 17121525
Spermatogenesis defects	MIK: 24524831
Male factor infertility	MIK: 24524831
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Male factor infertility	MIK: 29961538
Spermatogenetic defects	MIK: 24524831
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24524831	Male infertility, Spermatogenetic defects			40 (30 infertile men with normal CFTR and AZF tests and karyotype, 10 fertile male controls)	Male infertility
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq