• Gene id: 202151

Gene Summary

• Gene Symbol: RANBP3L   Gene   UCSC   Ensembl
• Gene name: RAN binding protein 3 like
• Alternate names: ran-binding protein 3-like,
• Gene location: 5p13.2 (36301901: 36246912)     Exons: 15     NC_000005.10
• OMIM: 605054

Protein Summary

• Protein general information: Q86VV4  
  • Name: Ran binding protein 3 like
  • Length: 465  
  • Mass: 52211
• Sequence:

  MTTIPRKGSSHLPGSLHTCKLKLQEDRRQQEKSVIAQPIFVFEKGEQTFKRPAEDTLYEAAEPECNGFPTKRVRS
  SSFTFHITDSQSQGVRKNNVFMTSALVQSSVDIKSAEQGPVKHSKHVIRPAILQLPQARSCAKVRKTFGHKALES
  CKTKEKTNNKISEGNSYLLSENLSRARISVQLSTNQDFLGATSVGCQPNEDKCSFKSCSSNFVFGENMVERVLGT
  QKLTQPQLENDSYAKEKPFKSIPKFPVNFLSSRTDSIKNTSLIESAAAFSSQPSRKCLLEKIDVITGEETEHNVL
  KINCKLFIFNKTTQSWIERGRGTLRLNDTASTDCGTLQSRLIMRNQGSLRLILNSKLWAQMKIQRANHKNVRITA
  TDLEDYSIKIFLIQASAQDTAYLYAAIHHRLVALQSFNKQRDVNQAESLSETAQQLNCESCDENEDDFIQVTKNG
  SDPSSWTHRQSVACS

• Structural information:
  • Protein Domains: (276..41-)
    (/note="RanBD1-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00164"-)
  • Interpro: IPR011993  IPR000156  
  • Prosite: PS50196
  • STRING: ENSP00000421853
• Other Databases: GeneCards:  RANBP3L  Malacards:  RANBP3L

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006611	protein export from nucleus	IBA	biological process
GO:0005643	nuclear pore	IBA	cellular component
GO:0008536	Ran GTPase binding	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0005096	GTPase activator activity	IBA	contributes to
GO:0046332	SMAD binding	IPI	molecular function
GO:1901706	mesenchymal cell differentiation involved in bone development	ISS	biological process
GO:0045668	negative regulation of osteoblast differentiation	ISS	biological process
GO:0045663	positive regulation of myoblast differentiation	ISS	biological process
GO:0046907	intracellular transport	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0043547	positive regulation of GTPase activity	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881