• Gene id: 201798

Gene Summary

• Gene Symbol: TIGD4   Gene   UCSC   Ensembl
• Gene name: tigger transposable element derived 4
• Alternate names: tigger transposable element-derived protein 4,
• Gene location: 4q31.3 (126804071: 126838209)     Exons: 6     NC_000009.12
• Gene summary(Entrez): The protein encoded by this gene belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons in humans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 and mariner transposa

Protein Summary

• Protein general information: Q8IY51  
  • Name: Tigger transposable element derived protein 4
  • Length: 512  
  • Mass: 57468
• Sequence:

  MAEASVDASTLPVTVKKKKSLSIEEKIDIINAVESGKKKAEIAAEYGIKKNSLSSIMKNKDKVLEAFESLRFDPK
  RKRLRTAFYTDLEEALMRWYRIAQCLNVPVNGPMLRLKANDFAQKLGHNDFKCSNGWLDRFKSRYGLVFRAQPVE
  ATGVPVDPSTVWYQNVLPYYLNDYHPKNVFNIKETGLLYRMLPTNTFAFKGETCSVGKLCKDRITLVVGTNMDGS
  EKLPLLVIGKKRTPHCFKGLKSLPVCYEANRMAWMTSDVFEQWMRKLDEEFQAQQRRVVIFVESFPAHPEVKNLK
  SIELAFFPSCLSSKCIAMKQGVIKSLKIKYRHCLIKKFLSSVEGSKEFTFSLLDAVDTLHLCWRAVTPETIVKSY
  EEAGFKSQKGESDITNAEKDTGLDLVADALGAGVEFPEGLSIEEYAALDDDLETCEAAPNGDSICTKESKSDETG
  FYTSDEEDDDGSPGTELPLPSKSEAITALDTLKKFLRSQDMNDGLQNSLADLENFINSLSPK

• Structural information:
  • Protein Domains: (12..6-)
    (/note="HTH-psq-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00320-)
    (75..14-)
    (/note="HTH-CENPB-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00583-)
    (174..37-)
    (/note="DDE-1-)
    (/evidence="ECO:0000255"-)
  • Interpro: IPR004875  IPR009057  IPR006600  IPR007889  
  • Prosite: PS51253 PS50960
  • STRING: ENSP00000355162
• Other Databases: GeneCards:  TIGD4  Malacards:  TIGD4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003677	DNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)