• Gene id: 201725

Gene Summary

• Gene Symbol: C4orf46   Gene   UCSC   Ensembl
• Aliases: RCDG1
• Gene name: chromosome 4 open reading frame 46
• Alternate names: renal cancer differentiation gene 1 protein,
• Gene location: 4q32.1 (183099586: 183015217)     Exons: 22     NC_000003.12
• Gene summary(Entrez): This gene encodes a small, conserved protein of unknown function that is expressed in a variety of tissues. There are pseudogenes for this gene on chromosomes 6, 8, 16, and X. Alternative splicing results in multiple transcript variants. [provided by RefS
• OMIM: 616210

Protein Summary

• Protein general information: Q504U0  
  • Name: Renal cancer differentiation gene 1 protein
  • Length: 113  
  • Mass: 11899
  • Tissue specificity: Expressed in the kidney, in epithelial cells in both proximal tubules and distal convoluted tubules. {ECO
• Sequence:

  MADPEELQVSSPPPPPPSSPSSSDASAASSPGGPVSLGWPVPSRSSGPTVDQLEEVELQIGDAAFSLTKLLEATS
  AVSAQVEELAFKCTENARFLKTWRDLLKEGYDSLKPDD

• Structural information:
  • Interpro: IPR031457  
  • STRING: ENSP00000368503
• Other Databases: GeneCards:  C4orf46  Malacards:  C4orf46

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)