• Gene id: 201595

Gene Summary

• Gene Symbol: STT3B   Gene   UCSC   Ensembl
• Aliases: CDG1X, SIMP, STT3-B
• Gene name: STT3 oligosaccharyltransferase complex catalytic subunit B
• Alternate names: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B, STT3, subunit of the oligosaccharyltransferase complex, homolog B, STT3B, catalytic subunit of the oligosaccharyltransferase complex, STT3B, subunit of the oligosaccharyltransferas,
• Gene location: 3p23 (31532637: 31637620)     Exons: 18     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene is a catalytic subunit of a protein complex that transfers oligosaccharides onto asparagine residues. Defects in this gene are a cause of congenital disorder of glycosylation Ix (CDG1X). [provided by RefSeq, Jun 2014]
• OMIM: 608605

Protein Summary

• Protein general information: Q8TCJ2  
  • Name: Dolichyl diphosphooligosaccharide protein glycosyltransferase subunit STT3B (Oligosaccharyl transferase subunit STT3B) (STT3 B) (EC 2.4.99.18) (Source of immunodominant MHC associated peptides homolog)
  • Length: 826  
  • Mass: 93674
  • Tissue specificity: Expressed in heart, brain, placenta, lung, liver, muscle, kidney and pancreas. Expressed in skin fibroblasts (at protein level). {ECO
• Sequence:

  MAEPSAPESKHKSSLNSSPWSGLMALGNSRHGHHGPGAQCAHKAAGGAAPPKPAPAGLSGGLSQPAGWQSLLSFT
  ILFLAWLAGFSSRLFAVIRFESIIHEFDPWFNYRSTHHLASHGFYEFLNWFDERAWYPLGRIVGGTVYPGLMITA
  GLIHWILNTLNITVHIRDVCVFLAPTFSGLTSISTFLLTRELWNQGAGLLAACFIAIVPGYISRSVAGSFDNEGI
  AIFALQFTYYLWVKSVKTGSVFWTMCCCLSYFYMVSAWGGYVFIINLIPLHVFVLLLMQRYSKRVYIAYSTFYIV
  GLILSMQIPFVGFQPIRTSEHMAAAGVFALLQAYAFLQYLRDRLTKQEFQTLFFLGVSLAAGAVFLSVIYLTYTG
  YIAPWSGRFYSLWDTGYAKIHIPIIASVSEHQPTTWVSFFFDLHILVCTFPAGLWFCIKNINDERVFVALYAISA
  VYFAGVMVRLMLTLTPVVCMLSAIAFSNVFEHYLGDDMKRENPPVEDSSDEDDKRNQGNLYDKAGKVRKHATEQE
  KTEEGLGPNIKSIVTMLMLMLLMMFAVHCTWVTSNAYSSPSVVLASYNHDGTRNILDDFREAYFWLRQNTDEHAR
  VMSWWDYGYQIAGMANRTTLVDNNTWNNSHIALVGKAMSSNETAAYKIMRTLDVDYVLVIFGGVIGYSGDDINKF
  LWMVRIAEGEHPKDIRESDYFTPQGEFRVDKAGSPTLLNCLMYKMSYYRFGEMQLDFRTPPGFDRTRNAEIGNKD
  IKFKHLEEAFTSEHWLVRIYKVKAPDNRETLDHKPRVTNIFPKQKYLSKKTTKRKRGYIKNKLVFKKGKKISKKT
  V

• Structural information:
  • Interpro: IPR003674  
  • PDB: 6S7T
  • PDBsum: 6S7T
  • STRING: ENSP00000295770
• Other Databases: GeneCards:  STT3B  Malacards:  STT3B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008250	oligosaccharyltransferase complex	IDA	is active in
GO:0004579	dolichyl-diphosphooligosaccharide-protein glycotransferase activity	IMP	molecular function
GO:0006487	protein N-linked glycosylation	IMP	biological process
GO:0043687	post-translational protein modification	IBA	biological process
GO:0004579	dolichyl-diphosphooligosaccharide-protein glycotransferase activity	IBA	molecular function
GO:0018279	protein N-linked glycosylation via asparagine	IBA	biological process
GO:0043687	post-translational protein modification	IMP	biological process
GO:0043687	post-translational protein modification	IMP	biological process
GO:0008250	oligosaccharyltransferase complex	TAS	cellular component
GO:0008250	oligosaccharyltransferase complex	TAS	cellular component
GO:0006986	response to unfolded protein	IMP	biological process
GO:0006986	response to unfolded protein	IMP	biological process
GO:0004579	dolichyl-diphosphooligosaccharide-protein glycotransferase activity	IMP	molecular function
GO:0004579	dolichyl-diphosphooligosaccharide-protein glycotransferase activity	IMP	molecular function
GO:0043686	co-translational protein modification	IMP	biological process
GO:0030433	ubiquitin-dependent ERAD pathway	IMP	biological process
GO:0018279	protein N-linked glycosylation via asparagine	IMP	biological process
GO:0018279	protein N-linked glycosylation via asparagine	IMP	biological process
GO:0006516	glycoprotein catabolic process	IMP	biological process
GO:0006486	protein glycosylation	IEA	biological process
GO:0004576	oligosaccharyl transferase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0004579	dolichyl-diphosphooligosaccharide-protein glycotransferase activity	IEA	molecular function
GO:0032991	protein-containing complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0006486	protein glycosylation	IEA	biological process
GO:0016020	membrane	HDA	cellular component
GO:0018279	protein N-linked glycosylation via asparagine	ISS	biological process
GO:0034998	oligosaccharyltransferase I complex	ISS	cellular component
GO:0004579	dolichyl-diphosphooligosaccharide-protein glycotransferase activity	ISS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04141	Protein processing in endoplasmic reticulum
hsa00510	N-Glycan biosynthesis
hsa00513	Various types of N-glycan biosynthesis

Diseases

Associated diseases	References
Congenital disorders of glycosylation type I	KEGG:H00118
Congenital disorders of glycosylation type I	KEGG:H00118
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray