• Gene id: 201516

Gene Summary

• Gene Symbol: ZSCAN4   Gene   UCSC   Ensembl
• Aliases: ZNF494
• Gene name: zinc finger and SCAN domain containing 4
• Alternate names: zinc finger and SCAN domain-containing protein 4, zinc finger protein 494,
• Gene location: 19q13.43 (57651496: 57679151)     Exons: 10     NC_000019.10
• Gene summary(Entrez): The ZSCAN4 gene encodes a protein involved in telomere maintenance and with a key role in the critical feature of mouse embryonic stem (ES) cells, namely, defying cellular senescence and maintaining normal karyotype for many cell divisions in culture (Zal
• OMIM: 613336

Protein Summary

• Protein general information: Q8NAM6  
  • Name: Zinc finger and SCAN domain containing protein 4 (Zinc finger protein 494)
  • Length: 433  
  • Mass: 48957
• Sequence:

  MALDLRTIFQCEPSENNLGSENSAFQQSQGPAVQREEGISEFSRMVLNSFQDSNNSYARQELQRLYRIFHSWLQP
  EKHSKDEIISLLVLEQFMIGGHCNDKASVKEKWKSSGKNLERFIEDLTDDSINPPALVHVHMQGQEALFSEDMPL
  RDVIVHLTKQVNAQTTREANMGTPSQTSQDTSLETGQGYEDEQDGWNSSSKTTRVNENITNQGNQIVSLIIIQEE
  NGPRPEEGGVSSDNPYNSKRAELVTARSQEGSINGITFQGVPMVMGAGCISQPEQSSPESALTHQSNEGNSTCEV
  HQKGSHGVQKSYKCEECPKVFKYLCHLLAHQRRHRNERPFVCPECQKGFFQISDLRVHQIIHTGKKPFTCSMCKK
  SFSHKTNLRSHERIHTGEKPYTCPFCKTSYRQSSTYHRHMRTHEKITLPSVPSTPEAS

• Structural information:
  • Protein Domains: (44..12-)
    (/note="SCAN-box)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00187"-)
  • Interpro: IPR003309  IPR038269  IPR036236  IPR013087  
  • Prosite: PS50804 PS00028 PS50157
  • CDD: cd07936
  • STRING: ENSP00000321963
• Other Databases: GeneCards:  ZSCAN4  Malacards:  ZSCAN4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0010833	telomere maintenance via telomere lengthening	ISS	biological process
GO:0000784	nuclear chromosome, telomeric region	ISS	cellular component
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0000781	chromosome, telomeric region	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0010833	telomere maintenance via telomere lengthening	ISS	biological process
GO:0045950	negative regulation of mitotic recombination	ISS	biological process
GO:0000784	nuclear chromosome, telomeric region	ISS	cellular component
GO:0000781	chromosome, telomeric region	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray