• Gene id: 201501

Gene Summary

• Gene Symbol: ZBTB7C   Gene   UCSC   Ensembl
• Aliases: APM-1, APM1, ZBTB36, ZNF857C
• Gene name: zinc finger and BTB domain containing 7C
• Alternate names: zinc finger and BTB domain-containing protein 7C, B230208J24Rik, affected by papillomavirus DNA integration in ME180 cells protein 1, zinc finger and BTB domain containing 36, zinc finger and BTB domain-containing protein 36, zinc finger protein 857C,
• Gene location: 18q21.1 (48412638: 48026671)     Exons: 19     NC_000018.10

Protein Summary

• Protein general information: A1YPR0  
  • Name: Zinc finger and BTB domain containing protein 7C (Affected by papillomavirus DNA integration in ME180 cells protein 1) (APM 1) (Zinc finger and BTB domain containing protein 36) (Zinc finger protein 857C)
  • Length: 619  
  • Mass: 69017
  • Tissue specificity: Detected in normal cervical keratinocytes, and in some cervical carcinoma cell lines. {ECO
• Sequence:

  MANDIDELIGIPFPNHSSEVLCSLNEQRHDGLLCDVLLVVQEQEYRTHRSVLAACSKYFKKLFTAGTLASQPYVY
  EIDFVQPEALAAILEFAYTSTLTITAGNVKHILNAARMLEIQCIVNVCLEIMEPGGDGGEEDDKEDDDDDEDDDD
  EEDEEEEEEEEEDDDDDTEDFADQENLPDPQDISCHQSPSKTDHLTEKAYSDTPRDFPDSFQAGSPGHLGVIRDF
  SIESLLRENLYPKANIPDRRPSLSPFAPDFFPHLWPGDFGAFAQLPEQPMDSGPLDLVIKNRKIKEEEKEELPPP
  PPPPFPNDFFKDMFPDLPGGPLGPIKAENDYGAYLNFLSATHLGGLFPPWPLVEERKLKPKASQQCPICHKVIMG
  AGKLPRHMRTHTGEKPYMCTICEVRFTRQDKLKIHMRKHTGERPYLCIHCNAKFVHNYDLKNHMRIHTGVRPYQC
  EFCYKSFTRSDHLHRHIKRQSCRMARPRRGRKPAAWRAASLLFGPGGPAPDKAAFVMPPALGEVGGHLGGAAVCL
  PGPSPAKHFLAAPKGALSLQELERQFEETQMKLFGRAQLEAERNAGGLLAFALAENVAAARPYFPLPDPWAAGLA
  GLPGLAGLNHVASMSEANN

• Structural information:
  • Protein Domains: (34..10-)
    (/note="BTB-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00037"-)
  • Interpro: IPR016024  IPR000210  IPR011333  IPR036236  IPR013087  
  • Prosite: PS50097 PS00028 PS50157
  • DIP: 61583
  • STRING: ENSP00000468782
• Other Databases: GeneCards:  ZBTB7C  Malacards:  ZBTB7C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0003700	DNA-binding transcription factor activity	IBA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:1903025	regulation of RNA polymerase II regulatory region sequence-specific DNA binding	IEA	biological process
GO:0045600	positive regulation of fat cell differentiation	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0008285	negative regulation of cell population proliferation	IDA	biological process
GO:0005575	cellular_component	ND	cellular component
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq