• Gene id: 201266

Gene Summary

• Gene Symbol: SLC39A11   Gene   UCSC   Ensembl
• Aliases: C17orf26, ZIP-11, ZIP11
• Gene name: solute carrier family 39 member 11
• Alternate names: zinc transporter ZIP11, Zrt- and Irt-like protein 11, solute carrier family 39 (metal ion transporter), member 11,
• Gene location: 17q24.3-q25.1 (73092713: 72645948)     Exons: 21     NC_000017.11
• OMIM: 616508

Protein Summary

• Protein general information: Q8N1S5  
  • Name: Zinc transporter ZIP11 (Solute carrier family 39 member 11) (Zrt and Irt like protein 11) (ZIP 11)
  • Length: 342  
  • Mass: 35396
• Sequence:

  MLQGHSSVFQALLGTFFTWGMTAAGAALVFVFSSGQRRILDGSLGFAAGVMLAASYWSLLAPAVEMATSSGGFGA
  FAFFPVAVGFTLGAAFVYLADLLMPHLGAAEDPQTTLALNFGSTLMKKKSDPEGPALLFPESELSIRIGRAGLLS
  DKSENGEAYQRKKAAATGLPEGPAVPVPSRGNLAQPGGSSWRRIALLILAITIHNVPEGLAVGVGFGAIEKTASA
  TFESARNLAIGIGIQNFPEGLAVSLPLRGAGFSTWRAFWYGQLSGMVEPLAGVFGAFAVVLAEPILPYALAFAAG
  AMVYVVMDDIIPEAQISGNGKLASWASILGFVVMMSLDVGLG

• Structural information:
  • Interpro: IPR003689  
  • STRING: ENSP00000445829
• Other Databases: GeneCards:  SLC39A11  Malacards:  SLC39A11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016020	membrane	IBA	cellular component
GO:0071577	zinc ion transmembrane transport	IBA	biological process
GO:0005385	zinc ion transmembrane transporter activity	IBA	molecular function
GO:0005385	zinc ion transmembrane transporter activity	ISS	molecular function
GO:0005794	Golgi apparatus	ISS	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0030001	metal ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0046873	metal ion transmembrane transporter activity	IEA	molecular function
GO:0055085	transmembrane transport	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0006829	zinc ion transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005385	zinc ion transmembrane transporter activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq