• Gene id: 201254

Gene Summary

• Gene Symbol: CENPX   Gene   UCSC   Ensembl
• Aliases: CENP-X, D9, FAAP10, MHF2, STRA13
• Gene name: centromere protein X
• Alternate names: centromere protein X, FANCM associated histone fold protein 2, FANCM-interacting histone fold protein 2, Fanconi anemia-associated polypeptide of 10 kDa, retinoic acid-inducible gene D9 protein homolog, stimulated by retinoic acid 13 homolog, stimulated by reti,
• Gene location: 17q25.3 (82022929: 82018702)     Exons: 4     NC_000017.11
• OMIM: 615128

Protein Summary

• Protein general information: A8MT69  
  • Name: Centromere protein X (CENP X) (FANCM associated histone fold protein 2) (FANCM interacting histone fold protein 2) (Fanconi anemia associated polypeptide of 10 kDa) (Retinoic acid inducible gene D9 protein homolog) (Stimulated by retinoic acid gene 13 pro
  • Length: 81  
  • Mass: 8959
• Sequence:

  MEGAGAGSGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQAQAEDALRVDVDQLEKVLP
  QLLLDF

• Structural information:
  • Interpro: IPR018552  
  • PDB: 4DRA 4DRB 4E44 4E45 4NDY 4NE1 4NE3 4NE5 4NE6
  • PDBsum: 4DRA 4DRB 4E44 4E45 4NDY 4NE1 4NE3 4NE5 4NE6
  • STRING: ENSP00000376168
• Other Databases: GeneCards:  CENPX  Malacards:  CENPX

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000712	resolution of meiotic recombination intermediates	IBA	biological process
GO:0043240	Fanconi anaemia nuclear complex	IBA	cellular component
GO:0031297	replication fork processing	IBA	biological process
GO:0071821	FANCM-MHF complex	IBA	cellular component
GO:0071821	FANCM-MHF complex	IDA	cellular component
GO:0003690	double-stranded DNA binding	IDA	contributes to
GO:0043240	Fanconi anaemia nuclear complex	IDA	cellular component
GO:0043240	Fanconi anaemia nuclear complex	IDA	cellular component
GO:0003677	DNA binding	IDA	molecular function
GO:0031297	replication fork processing	IMP	biological process
GO:0031398	positive regulation of protein ubiquitination	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0000712	resolution of meiotic recombination intermediates	IMP	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0051382	kinetochore assembly	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0000776	kinetochore	IEA	cellular component
GO:0006281	DNA repair	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0034080	CENP-A containing nucleosome assembly	TAS	biological process
GO:0036297	interstrand cross-link repair	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000777	condensed chromosome kinetochore	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03460	Fanconi anemia pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881