• Gene id: 201176

Gene Summary

• Gene Symbol: ARHGAP27   Gene   UCSC   Ensembl
• Aliases: CAMGAP1, PP905, SH3D20, SH3P20
• Gene name: Rho GTPase activating protein 27
• Alternate names: rho GTPase-activating protein 27, CIN85-associated multi-domain-containing Rho GTPase-activating protein 1, SH3 domain containing 20, SH3 domain-containing protein 20, rho-type GTPase-activating protein 27,
• Gene location: 17q21.31 (45432915: 45393901)     Exons: 4     NC_000017.11
• Gene summary(Entrez): This gene encodes a member of a large family of proteins that activate Rho-type guanosine triphosphate (GTP) metabolizing enzymes. The encoded protein may pay a role in clathrin-mediated endocytosis. Alternatively spliced transcript variants encoding mult
• OMIM: 610591

Protein Summary

• Protein general information: Q6ZUM4  
  • Name: Rho GTPase activating protein 27 (CIN85 associated multi domain containing Rho GTPase activating protein 1) (Rho type GTPase activating protein 27) (SH3 domain containing protein 20)
  • Length: 889  
  • Mass: 98396
  • Tissue specificity: Expressed in germinal center B-cell, spleen, chronic lymphocytic leukemia, pancreatic cancer and lung cancer. {ECO
• Sequence:

  MAADVVGDVYVLVEHPFEYTGKDGRRVAIRPNERYRLLRRSTEHWWHVRREPGGRPFYLPAQYVRELPALGNPAA
  AAPPGPHPSPAAPEPLAYDYRFVSAAATAGPDGAPEESGGRASSLCGPAQRGAATQRSSLAPGLPACLYLRPAAP
  VRPAQSLNDLACAAVSPPAGLLGSSGSFKACSVAGSWVCPRPLARSDSENVYEVIQDLHVPPPEESAEQVDDPPE
  PVYANIERQPRATSPGAAAAPLPSPVWETHTDAGTGRPYYYNPDTGVTTWESPFEAAEGAASPATSPASVDSHVS
  LETEWGQYWDEESRRVFFYNPLTGETAWEDEAENEPEEELEMQPGLSPGSPGDPRPPTPETDYPESLTSYPEEDY
  SPVGSFGEPGPTSPLTTPPGWSCHVSQDKQMLYTNHFTQEQWVRLEDPHGKPYFYNPEDSSVRWELPQVPVPAPR
  SIHKSSQDGDTPAQASPPEEKVPAELDEVGSWEEVSPATAAVRTKTLDKAGVLHRTKTADKGKRLRKKHWSASWT
  VLEGGVLTFFKDSKTSAAGGLRQPSKFSTPEYTVELRGATLSWAPKDKSSRKNVLELRSRDGSEYLIQHDSEAII
  STWHKAIAQGIQELSAELPPEESESSRVDFGSSERLGSWQEKEEDARPNAAAPALGPVGLESDLSKVRHKLRKFL
  QRRPTLQSLREKGYIKDQVFGCALAALCERERSRVPRFVQQCIRAVEARGLDIDGLYRISGNLATIQKLRYKVDH
  DERLDLDDGRWEDVHVITGALKLFFRELPEPLFPFSHFRQFIAAIKLQDQARRSRCVRDLVRSLPAPNHDTLRML
  FQHLCRVIEHGEQNRMSVQSVAIVFGPTLLRPEVEETSMPMTMVFQNQVVELILQQCADIFPPH

• Structural information:
  • Protein Domains: (6..6-)
    (/note="SH3-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00192-)
    (246..28-)
    (/note="WW-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00224-)
    (299..33-)
    (/note="WW-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00224-)
    (411-)
  • Interpro: IPR011993  IPR001849  IPR011047  IPR008936  IPR000198   IPR036028  IPR001452  IPR001202  IPR036020  
  • Prosite: PS50003 PS50238 PS50002 PS50020
  • CDD: cd00201
  • PDB: 3PP2
  • PDBsum: 3PP2
  • STRING: ENSP00000403323
• Other Databases: GeneCards:  ARHGAP27  Malacards:  ARHGAP27

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005096	GTPase activator activity	ISS	molecular function
GO:0017124	SH3 domain binding	ISS	molecular function
GO:0006898	receptor-mediated endocytosis	ISS	biological process
GO:0043547	positive regulation of GTPase activity	ISS	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0043087	regulation of GTPase activity	IBA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0006897	endocytosis	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)