• Gene id: 201161

Gene Summary

• Gene Symbol: CENPV   Gene   UCSC   Ensembl
• Aliases: 3110013H01Rik, CENP-V, PRR6, p30
• Gene name: centromere protein V
• Alternate names: centromere protein V, nuclear protein p30, proline rich 6, proline-rich protein 6,
• Gene location: 17p11.2 (16353468: 16342536)     Exons: 5     NC_000017.11

Protein Summary

• Protein general information: Q7Z7K6  
  • Name: Centromere protein V (CENP V) (Nuclear protein p30) (Proline rich protein 6)
  • Length: 275  
  • Mass: 29946
• Sequence:

  MRRSRSSAAAKLRGQKRSGASGASAAPAASAAAALAPSATRTRRSASQAGSKSQAVEKPPSEKPRLRRSSPRAQE
  EGPGEPPPPELALLPPPPPPPPTPATPTSSASNLDLGEQRERWETFQKRQKLTSEGAAKLLLDTFEYQGLVKHTG
  GCHCGAVRFEVWASADLHIFDCNCSICKKKQNRHFIVPASRFKLLKGAEHITTYTFNTHKAQHTFCKRCGVQSFY
  TPRSNPGGFGIAPHCLDEGTVRSMVTEEFNGSDWEKAMKEHKTIKNMSKE

• Structural information:
  • Protein Domains: (148..26-)
    (/note="CENP-V/GFA-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01239"-)
  • Interpro: IPR006913  IPR011057  
  • Prosite: PS51891
  • STRING: ENSP00000299736
• Other Databases: GeneCards:  CENPV  Malacards:  CENPV

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0033044	regulation of chromosome organization	IBA	biological process
GO:0031508	pericentric heterochromatin assembly	IBA	biological process
GO:0000776	kinetochore	IBA	cellular component
GO:0051233	spindle midzone	IBA	cellular component
GO:0032467	positive regulation of cytokinesis	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0016846	carbon-sulfur lyase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0051301	cell division	IEA	biological process
GO:0000776	kinetochore	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0001667	ameboidal-type cell migration	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0000777	condensed chromosome kinetochore	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0030496	midbody	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0051233	spindle midzone	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0000776	kinetochore	IDA	cellular component
GO:0032467	positive regulation of cytokinesis	IMP	biological process
GO:0003674	molecular_function	ND	molecular function
GO:0034508	centromere complex assembly	IMP	biological process
GO:0033044	regulation of chromosome organization	IMP	biological process
GO:0031508	pericentric heterochromatin assembly	IMP	biological process

Diseases

Associated diseases	References
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray