• Gene id: 2011

Gene Summary

• Gene Symbol: MARK2   Gene   UCSC   Ensembl
• Aliases: EMK-1, EMK1, PAR-1, Par-1b, Par1b
• Gene name: microtubule affinity regulating kinase 2
• Alternate names: serine/threonine-protein kinase MARK2, ELKL motif kinase 1, MAP/microtubule affinity-regulating kinase 2, PAR1 homolog b, Ser/Thr protein kinase PAR-1B, serine/threonine protein kinase EMK, testicular tissue protein Li 117,
• Gene location: 11q13.1 (63838927: 63911019)     Exons: 22     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the Par-1 family of serine/threonine protein kinases. The protein is an important regulator of cell polarity in epithelial and neuronal cells, and also controls the stability of microtubules through phosphorylation and inacti
• OMIM: 600526

Protein Summary

• Protein general information: Q7KZI7  
  • Name: Serine/threonine protein kinase MARK2 (EC 2.7.11.1) (EC 2.7.11.26) (ELKL motif kinase 1) (EMK 1) (MAP/microtubule affinity regulating kinase 2) (PAR1 homolog) (PAR1 homolog b) (Par 1b) (Par1b)
  • Length: 788  
  • Mass: 87911
  • Tissue specificity: High levels of expression in heart, brain, skeletal muscle and pancreas, lower levels observed in lung, liver and kidney. {ECO
• Sequence:

  MSSARTPLPTLNERDTEQPTLGHLDSKPSSKSNMIRGRNSATSADEQPHIGNYRLLKTIGKGNFAKVKLARHILT
  GKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEK
  EARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGFSNEFTFGNKLDTFCGSPPYAAPELFQGKK
  YDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMK
  DRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGYKSSELEGDTITL
  KPRPSADLTNSSAPSPSHKVQRSVSANPKQRRFSDQAAGPAIPTSNSYSKKTQSNNAENKRPEEDRESGRKASST
  AKVPASPLPGLERKKTTPTPSTNSVLSTSTNRSRNSPLLERASLGQASIQNGKDSLTMPGSRASTASASAAVSAA
  RPRQHQKSMSASVHPNKASGLPPTESNCEVPRPSTAPQRVPVASPSAHNISSSGGAPDRTNFPRGVSSRSTFHAG
  QLRQVRDQQNLPYGVTPASPSGHSQGRRGASGSIFSKFTSKFVRRNLSFRFARRNLNEPESKDRVETLRPHVVGS
  GGNDKEKEEFREAKPRSLRFTWSMKTTSSMEPNEMMREIRKVLDANSCQSELHEKYMLLCMHGTPGHEDFVQWEM
  EVCKLPRLSLNGVRFKRISGTSMAFKNIASKIANELKL

• Structural information:
  • Protein Domains: (53..30-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159-)
    (323..36-)
    (/note="UBA-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00212-)
    (739..78-)
    (/note="KA1-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00565"-)
  • Interpro: IPR028375  IPR001772  IPR011009  IPR000719  IPR017441   IPR008271  IPR015940  
  • Prosite: PS50032 PS00107 PS50011 PS00108 PS50030
  • PDB: 3IEC 5EAK 5KZ7 5KZ8
  • PDBsum: 3IEC 5EAK 5KZ7 5KZ8
  • DIP: 31321
  • STRING: ENSP00000385751
• Other Databases: GeneCards:  MARK2  Malacards:  MARK2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070507	regulation of microtubule cytoskeleton organization	IDA	biological process
GO:0004674	protein serine/threonine kinase activity	NAS	molecular function
GO:0004674	protein serine/threonine kinase activity	ISS	molecular function
GO:0048156	tau protein binding	NAS	molecular function
GO:0048156	tau protein binding	ISS	molecular function
GO:0050321	tau-protein kinase activity	NAS	molecular function
GO:0050321	tau-protein kinase activity	ISS	molecular function
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:1904526	regulation of microtubule binding	ISS	biological process
GO:0061564	axon development	ISS	biological process
GO:0018105	peptidyl-serine phosphorylation	ISS	biological process
GO:0018105	peptidyl-serine phosphorylation	ISS	biological process
GO:0071963	establishment or maintenance of cell polarity regulating cell shape	ISS	biological process
GO:0030295	protein kinase activator activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0051646	mitochondrion localization	NAS	biological process
GO:0005739	mitochondrion	NAS	cellular component
GO:0000422	autophagy of mitochondrion	NAS	biological process
GO:0032147	activation of protein kinase activity	TAS	biological process
GO:0018107	peptidyl-threonine phosphorylation	TAS	biological process
GO:0000226	microtubule cytoskeleton organization	IBA	biological process
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0050321	tau-protein kinase activity	IBA	molecular function
GO:0030010	establishment of cell polarity	IDA	biological process
GO:0016328	lateral plasma membrane	IDA	cellular component
GO:0030425	dendrite	IDA	cellular component
GO:0097427	microtubule bundle	IDA	cellular component
GO:0010976	positive regulation of neuron projection development	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005884	actin filament	IDA	cellular component
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0051493	regulation of cytoskeleton organization	ISS	biological process
GO:0050770	regulation of axonogenesis	IMP	biological process
GO:0050321	tau-protein kinase activity	ISS	molecular function
GO:0046777	protein autophosphorylation	ISS	biological process
GO:0030010	establishment of cell polarity	TAS	biological process
GO:0001764	neuron migration	ISS	biological process
GO:0050321	tau-protein kinase activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006468	protein phosphorylation	IMP	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0008289	lipid binding	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0006468	protein phosphorylation	TAS	biological process
GO:0050321	tau-protein kinase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045296	cadherin binding	HDA	molecular function
GO:0030425	dendrite	IEA	cellular component
GO:0016328	lateral plasma membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0045197	establishment or maintenance of epithelial cell apical/basal polarity	IDA	biological process
GO:0035556	intracellular signal transduction	IDA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0005524	ATP binding	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0000287	magnesium ion binding	IDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0016020	membrane	IMP	cellular component
GO:0006468	protein phosphorylation	NAS	biological process
GO:0004674	protein serine/threonine kinase activity	NAS	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray