• Gene id: 200933

Gene Summary

• Gene Symbol: FBXO45   Gene   UCSC   Ensembl
• Aliases: Fbx45
• Gene name: F-box protein 45
• Alternate names: F-box/SPRY domain-containing protein 1, F-box only protein 45, hFbxo45,
• Gene location: 3q29 (196568659: 196589058)     Exons: 3     NC_000003.12
• Gene summary(Entrez): Members of the F-box protein family, such as FBXO45, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box pr

Protein Summary

• Protein general information: P0C2W1  
  • Name: F box/SPRY domain containing protein 1 (F box only protein 45) (hFbxo45)
  • Length: 286  
  • Mass: 30633
• Sequence:

  MAAPAPGAGAASGGAGCSGGGAGAGAGSGSGAAGAGGRLPSRVLELVFSYLELSELRSCALVCKHWYRCLHGDEN
  SEVWRSLCARSLAEEALRTDILCNLPSYKAKIRAFQHAFSTNDCSRNVYIKKNGFTLHRNPIAQSTDGARTKIGF
  SEGRHAWEVWWEGPLGTVAVIGIATKRAPMQCQGYVALLGSDDQSWGWNLVDNNLLHNGEVNGSFPQCNNAPKYQ
  IGERIRVILDMEDKTLAFERGYEFLGVAFRGLPKVCLYPAVSAVYGNTEVTLVYLGKPLDG

• Structural information:
  • Protein Domains: (33..8-)
    (/note="F-box-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00080-)
    (92..28-)
    (/note="B30.2/SPRY-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00548"-)
  • Interpro: IPR001870  IPR013320  IPR036047  IPR001810  IPR003877   IPR035784  
  • Prosite: PS50188 PS50181
  • CDD: cd12907
  • STRING: ENSP00000310332
• Other Databases: GeneCards:  FBXO45  Malacards:  FBXO45

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0060386	synapse assembly involved in innervation	IBA	biological process
GO:0045202	synapse	IBA	cellular component
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0019005	SCF ubiquitin ligase complex	IBA	cellular component
GO:0006511	ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0016567	protein ubiquitination	IDA	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	ISS	biological process
GO:0016567	protein ubiquitination	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0014069	postsynaptic density	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0021960	anterior commissure morphogenesis	IEA	biological process
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0060384	innervation	IEA	biological process
GO:0060386	synapse assembly involved in innervation	IEA	biological process
GO:0098793	presynapse	IEA	cellular component
GO:0099524	postsynaptic cytosol	IEA	cellular component
GO:0001764	neuron migration	IEA	biological process
GO:0021799	cerebral cortex radially oriented cell migration	IEA	biological process
GO:0021800	cerebral cortex tangential migration	IEA	biological process
GO:0021957	corticospinal tract morphogenesis	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0099523	presynaptic cytosol	IEA	cellular component
GO:0042734	presynaptic membrane	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process

Diseases

Associated diseases	References
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray