Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 200894
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary
Gene Symbol ARL13B   Gene   UCSC   Ensembl
Aliases ARL2L1, JBTS8
Gene name ADP ribosylation factor like GTPase 13B
Alternate names ADP-ribosylation factor-like protein 13B, ADP-ribosylation factor-like 13B, ADP-ribosylation factor-like 2-like 1, ARL2-like protein 1,
Gene location 3q11.1-q11.2 (93980138: 94055677)     Exons: 14     NC_000003.12
Gene summary(Entrez) This gene encodes a member of the ADP-ribosylation factor-like family. The encoded protein is a small GTPase that contains both N-terminal and C-terminal guanine nucleotide-binding motifs. This protein is localized in the cilia and plays a role in cilia f
OMIM 608922

Protein Summary
Protein general information Q3SXY8  

Name: ADP ribosylation factor like protein 13B (ADP ribosylation factor like protein 2 like 1) (ARL2 like protein 1)

Length: 428  Mass: 48643

Tissue specificity: Expressed in the developing brain. {ECO

Sequence MFSLMASCCGWFKRWREPVRKVTLLMVGLDNAGKTATAKGIQGEYPEDVAPTVGFSKINLRQGKFEVTIFDLGGG
IRIRGIWKNYYAESYGVIFVVDSSDEERMEETKEAMSEMLRHPRISGKPILVLANKQDKEGALGEADVIECLSLE
KLVNEHKCLCQIEPCSAISGYGKKIDKSIKKGLYWLLHVIARDFDALNERIQKETTEQRALEEQEKQERAERVRK
LREERKQNEQEQAELDGTSGLAELDPEPTNPFQPIASVIIENEGKLEREKKNQKMEKDSDGCHLKHKMEHEQIET
QGQVNHNGQKNNEFGLVENYKEALTQQLKNEDETDRPSLESANGKKKTKKLRMKRNHRVEPLNIDDCAPESPTPP
PPPPPVGWGTPKVTRLPKLEPLGETHHNDFYRKPLPPLAVPQRPNSDAHDVIS
Structural information
Interpro:  IPR027417  IPR005225  IPR006689  
Prosite:   PS51417
STRING:   ENSP00000377769
Other Databases GeneCards:  ARL13B  Malacards:  ARL13B

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0097730 non-motile cilium
 IBA cellular component
GO:1905515 non-motile cilium assembl
y
 IBA biological process
GO:0097500 receptor localization to
non-motile cilium
 IBA biological process
GO:0060170 ciliary membrane
 IBA cellular component
GO:0031514 motile cilium
 IBA cellular component
GO:0005929 cilium
 IBA cellular component
GO:0060271 cilium assembly
 ISS biological process
GO:0021830 interneuron migration fro
m the subpallium to the c
ortex
 ISS biological process
GO:0060170 ciliary membrane
 ISS cellular component
GO:1905515 non-motile cilium assembl
y
 ISS biological process
GO:0021943 formation of radial glial
scaffolds
 ISS biological process
GO:0021532 neural tube patterning
 ISS biological process
GO:0007224 smoothened signaling path
way
 ISS biological process
GO:0005929 cilium
 ISS cellular component
GO:0005525 GTP binding
 IEA molecular function
GO:0005525 GTP binding
 IEA molecular function
GO:0042995 cell projection
 IEA cellular component
GO:0005886 plasma membrane
 IEA cellular component
GO:0000166 nucleotide binding
 IEA molecular function
GO:0005929 cilium
 IEA cellular component
GO:0016020 membrane
 IEA cellular component
GO:0005929 cilium
 IDA cellular component
GO:0005929 cilium
 TAS cellular component
GO:0005929 cilium
 TAS cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0010226 response to lithium ion
 IEA biological process
GO:0001947 heart looping
 IEA biological process
GO:0005930 axoneme
 IEA cellular component
GO:0009953 dorsal/ventral pattern fo
rmation
 IEA biological process
GO:0021830 interneuron migration fro
m the subpallium to the c
ortex
 IEA biological process
GO:0060271 cilium assembly
 IEA biological process
GO:0097731 9+0 non-motile cilium
 IEA cellular component
GO:0005929 cilium
 IEA cellular component
GO:0007224 smoothened signaling path
way
 IEA biological process
GO:0007368 determination of left/rig
ht symmetry
 IEA biological process
GO:0021532 neural tube patterning
 IEA biological process
GO:0021943 formation of radial glial
scaffolds
 IEA biological process
GO:0031514 motile cilium
 IEA cellular component
GO:0060170 ciliary membrane
 IEA cellular component
GO:0070986 left/right axis specifica
tion
 IEA biological process
GO:1905515 non-motile cilium assembl
y
 IEA biological process
GO:0060170 ciliary membrane
 IEA cellular component
GO:0005929 cilium
 IEA cellular component
GO:0005929 cilium
 IDA cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function

Diseases

Expand All | Collapse All
Associated diseases References
Joubert syndrome KEGG:H00530
Joubert syndrome KEGG:H00530
Joubert syndrome PMID:18674751
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia
13 (5 controls,
8 cases)
 Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract