• Gene id: 200765

Gene Summary

• Gene Symbol: TIGD1   Gene   UCSC   Ensembl
• Aliases: EEYORE
• Gene name: tigger transposable element derived 1
• Alternate names: tigger transposable element-derived protein 1,
• Gene location: 2q37.1 (232550556: 232543882)     Exons: 1     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons in humans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 and mariner transposa
• OMIM: 602288

Protein Summary

• Protein general information: Q96MW7  
  • Name: Tigger transposable element derived protein 1
  • Length: 591  
  • Mass: 67299
• Sequence:

  MASKCSSERKSRTSLTLNQKLEMIKLSEEGMSKAEIGRRLGLLRQTVSQVVNAKEKFLKEVKSATPMNTRMIRKR
  NSLIADMEKVLVVWIEDQTSRNIPLSQSLIQNKALTLFNSMKAERGVEAAEEKFEASRGWFMRFKERSHFHNIKA
  QGEAASADVEAAASYPEALAKIIDEGGYTKQQIFNVDETAFYWKKMPSRTFIAREEKSVPGFKASKDRLTLLLGA
  NAAGDFKLKPMLIYHSENPRALKNYTKSTLPVLYKWNSKARMTAHLFTAWFTEYFKPTVETYCSEKKIPFKILLL
  IDNAPSHPRALMEIYEEINVIFMPANTTSILQPMDQGVISTFKSYYLRNTFHKALAAMDSDVSDGSGQSKLKTFW
  KGFTILDAIKNIRDSWEEVKLSTLTGVWKKLIPTLIDDYEGFKTSVEEVSADVVEIAKELELEVEPEDVTELLQS
  HDKTLTDEELFLMDAQRKWFLEMESTPGEDAVNIVEMTTKDLEYYINLVDKAAAGFERIDSNFERSSTVGKMLSN
  SIACYREIFHERKSQLMRKASPMSYFRKLPQPPQPSAATTLTSQQPSTSRQDPPPAKRVRLTEGSD

• Structural information:
  • Protein Domains: (6..5-)
    (/note="HTH-psq-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00320-)
    (70..14-)
    (/note="HTH-CENPB-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00583-)
    (178..40-)
    (/note="DDE-1-)
    (/evidence="ECO:0000255"-)
  • Interpro: IPR004875  IPR009057  IPR006600  IPR007889  
  • Prosite: PS51253 PS50960
  • DIP: 61581
  • STRING: ENSP00000386186
• Other Databases: GeneCards:  TIGD1  Malacards:  TIGD1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003677	DNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881