• Gene id: 200539

Gene Summary

• Gene Symbol: ANKRD23   Gene   UCSC   Ensembl
• Aliases: DARP, MARP3
• Gene name: ankyrin repeat domain 23
• Alternate names: ankyrin repeat domain-containing protein 23, diabetes related ankyrin repeat protein, muscle ankyrin repeat protein 3,
• Gene location: 2q11.2 (96844020: 96837911)     Exons: 9     NC_000002.12
• Gene summary(Entrez): This gene is a member of the muscle ankyrin repeat protein (MARP) family and encodes a protein with four tandem ankyrin-like repeats. The protein is localized to the nucleus, functioning as a transcriptional regulator. Expression of this protein is induce
• OMIM: 610736

Protein Summary

• Protein general information: Q86SG2  
  • Name: Ankyrin repeat domain containing protein 23 (Diabetes related ankyrin repeat protein) (Muscle ankyrin repeat protein 3)
  • Length: 305  
  • Mass: 34297
  • Tissue specificity: Mainly expressed in heart, skeletal muscle and brown adipose tissues. {ECO
• Sequence:

  MDFISIQQLVSGERVEGKVLGFGHGVPDPGAWPSDWRRGPQEAVAREKLKLEEEKKKKLERFNSTRFNLDNLADL
  ENLVQRRKKRLRHRVPPRKPEPLVKPQSQAQVEPVGLEMFLKAAAENQEYLIDKYLTDGGDPNAHDKLHRTALHW
  ACLKGHSQLVNKLLVAGATVDARDLLDRTPVFWACRGGHLVILKQLLNQGARVNARDKIGSTPLHVAVRTRHPDC
  LEHLIECGAHLNAQDKEGDTALHEAVRHGSYKAMKLLLLYGAELGVRNAASVTPVQLARDWQRGIREALQAHVAH
  PRTRC

• Structural information:
  • Interpro: IPR028780  IPR002110  IPR020683  IPR036770  
  • Prosite: PS50297 PS50088
  • STRING: ENSP00000321679
• Other Databases: GeneCards:  ANKRD23  Malacards:  ANKRD23

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031432	titin binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0014704	intercalated disc	IEA	cellular component
GO:0009612	response to mechanical stimulus	IEA	biological process
GO:0030016	myofibril	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0031432	titin binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0015629	actin cytoskeleton	IDA	cellular component

Diseases

Associated diseases	References
congestive heart failure	PMID:15238456
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq