• Gene id: 2005

Gene Summary

• Gene Symbol: ELK4   Gene   UCSC   Ensembl
• Aliases: SAP1
• Gene name: ETS transcription factor ELK4
• Alternate names: ETS domain-containing protein Elk-4, ELK4, ETS transcription factor, ELK4, ETS-domain protein (SRF accessory protein 1), SAP-1, serum response factor accessory protein 1,
• Gene location: 1q32.1 (205632871: 205607942)     Exons: 5     NC_000001.11
• Gene summary(Entrez): This gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum reponse element in the promo
• OMIM: 600246

Protein Summary

• Protein general information: P28324  
  • Name: ETS domain containing protein Elk 4 (Serum response factor accessory protein 1) (SAP 1) (SRF accessory protein 1)
  • Length: 431  
  • Mass: 46900
• Sequence:

  MDSAITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKNKPNMNYDKLSRALRYYYVKNIIKKV
  NGQKFVYKFVSYPEILNMDPMTVGRIEGDCESLNFSEVSSSSKDVENGGKDKPPQPGAKTSSRNDYIHSGLYSSF
  TLNSLNSSNVKLFKLIKTENPAEKLAEKKSPQEPTPSVIKFVTTPSKKPPVEPVAATISIGPSISPSSEETIQAL
  ETLVSPKLPSLEAPTSASNVMTAFATTPPISSIPPLQEPPRTPSPPLSSHPDIDTDIDSVASQPMELPENLSLEP
  KDQDSVLLEKDKVNNSSRSKKPKGLELAPTLVITSSDPSPLGILSPSLPTASLTPAFFSQTPIILTPSPLLSSIH
  FWSTLSPVAPLSPARLQGANTLFQFPSVLNSHGPFTLSGLDGPSTPGPFSPDLQKT

• Structural information:
  • Interpro: IPR000418  IPR036388  IPR036390  
  • Prosite: PS00345 PS00346 PS50061
  • PDB: 1BC7 1BC8 1HBX 1K6O
  • PDBsum: 1BC7 1BC8 1HBX 1K6O
  • DIP: 59907
  • STRING: ENSP00000350681
• Other Databases: GeneCards:  ELK4  Malacards:  ELK4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0030154	cell differentiation	IBA	biological process
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0003682	chromatin binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IMP	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	TAS	molecular function
GO:0003700	DNA-binding transcription factor activity	NAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0070932	histone H3 deacetylation	IDA	biological process positive effect

KEGG pathways

Pathway id	Pathway name
hsa04010	MAPK signaling pathway
hsa05166	Human T-cell leukemia virus 1 infection
hsa05202	Transcriptional misregulation in cancer
P06959	CCKR signaling map

Diseases

Associated diseases	References
Prostate cancer	KEGG:H00024
Prostate cancer	KEGG:H00024
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray