• Gene id: 200316

Gene Summary

• Gene Symbol: APOBEC3F   Gene   UCSC   Ensembl
• Aliases: A3F, ARP8, BK150C2.4.MRNA, KA6
• Gene name: apolipoprotein B mRNA editing enzyme catalytic subunit 3F
• Alternate names: DNA dC->dU-editing enzyme APOBEC-3F, apolipoprotein B editing enzyme catalytic polypeptide-like 3F, apolipoprotein B mRNA editing enzyme cytidine deaminase, apolipoprotein B mRNA-editing enzyme catalytic polypeptide-like 3F, induced upon T-cell activation,
• Gene location: 22q13.1 (32818031: 32775237)     Exons: 14     NC_000001.11
• Gene summary(Entrez): This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and fu
• OMIM: 608993

Protein Summary

• Protein general information: Q8IUX4  
  • Name: DNA dC >dU editing enzyme APOBEC 3F (EC 3.5.4.38) (Apolipoprotein B mRNA editing enzyme catalytic polypeptide like 3F) (A3F)
  • Length: 373  
  • Mass: 45020
  • Tissue specificity: Widely expressed. Highly expressed in ovary. {ECO
• Sequence:

  MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLDAKIFRGQVYSQPEHHAEMCFLSWFC
  GNQLPAYKCFQITWFVSWTPCPDCVAKLAEFLAEHPNVTLTISAARLYYYWERDYRRALCRLSQAGARVKIMDDE
  EFAYCWENFVYSEGQPFMPWYKFDDNYAFLHRTLKEILRNPMEAMYPHIFYFHFKNLRKAYGRNESWLCFTMEVV
  KHHSPVSWKRGVFRNQVDPETHCHAERCFLSWFCDDILSPNTNYEVTWYTSWSPCPECAGEVAEFLARHSNVNLT
  IFTARLYYFWDTDYQEGLRSLSQEGASVEIMGYKDFKYCWENFVYNDDEPFKPWKGLKYNFLFLDSKLQEILE

• Structural information:
  • Protein Domains: (29..13-)
    1 (/note="CMP/dCMP-type-deaminase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01083-)
    (174..32-)
    2 (/note="CMP/dCMP-type-deaminase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01083"-)
  • Interpro: IPR016192  IPR002125  IPR016193  
  • Prosite: PS00903 PS51747
  • PDB: 3WUS 4IOU 4J4J 5HX4 5HX5 5W2M 6NIL
  • PDBsum: 3WUS 4IOU 4J4J 5HX4 5HX5 5W2M 6NIL
  • DIP: 59966
  • STRING: ENSP00000309749
• Other Databases: GeneCards:  APOBEC3F  Malacards:  APOBEC3F

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008270	zinc ion binding	IDA	molecular function
GO:0003723	RNA binding	IDA	molecular function
GO:0004126	cytidine deaminase activity	IDA	molecular function
GO:0045087	innate immune response	IDA	biological process
GO:0016553	base conversion or substitution editing	IDA	biological process
GO:0030895	apolipoprotein B mRNA editing enzyme complex	TAS	cellular component
GO:0002230	positive regulation of defense response to virus by host	IDA	biological process
GO:0045869	negative regulation of single stranded viral RNA replication via double stranded DNA intermediate	IDA	biological process
GO:0048525	negative regulation of viral process	IDA	biological process
GO:0051607	defense response to virus	IBA	biological process
GO:0010529	negative regulation of transposition	IBA	biological process
GO:0000932	P-body	IBA	cellular component
GO:0080111	DNA demethylation	IBA	biological process
GO:0070383	DNA cytosine deamination	IBA	biological process
GO:0047844	deoxycytidine deaminase activity	IBA	molecular function
GO:0045869	negative regulation of single stranded viral RNA replication via double stranded DNA intermediate	IBA	biological process
GO:0016554	cytidine to uridine editing	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0004126	cytidine deaminase activity	IBA	molecular function
GO:0003723	RNA binding	IBA	molecular function
GO:0051607	defense response to virus	IDA	biological process
GO:0051607	defense response to virus	IDA	biological process
GO:0045071	negative regulation of viral genome replication	IDA	biological process
GO:1990904	ribonucleoprotein complex	IDA	cellular component
GO:0010529	negative regulation of transposition	IDA	biological process
GO:0010529	negative regulation of transposition	IDA	biological process
GO:0000932	P-body	IDA	cellular component
GO:0000932	P-body	IDA	cellular component
GO:0080111	DNA demethylation	IDA	biological process
GO:0070383	DNA cytosine deamination	IDA	biological process
GO:0045869	negative regulation of single stranded viral RNA replication via double stranded DNA intermediate	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0051607	defense response to virus	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0045087	innate immune response	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0045071	negative regulation of viral genome replication	IDA	biological process
GO:0000932	P-body	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0009972	cytidine deamination	IEA	biological process
GO:0009972	cytidine deamination	IEA	biological process
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05170	Human immunodeficiency virus 1 infection

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq