• Gene id: 200185

Gene Summary

• Gene Symbol: KRTCAP2   Gene   UCSC   Ensembl
• Aliases: KCP2
• Gene name: keratinocyte associated protein 2
• Alternate names: keratinocyte-associated protein 2, KCP-2, dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit KCP2, keratinocytes associated protein 2, oligosaccharyl transferase subunit KCP2,
• Gene location: 1q22 (155173303: 155169407)     Exons: 5     NC_000001.11
• OMIM: 0

Protein Summary

• Protein general information: Q8N6L1  
  • Name: Keratinocyte associated protein 2 (KCP 2) (Dolichyl diphosphooligosaccharide protein glycosyltransferase subunit KCP2) (Oligosaccharyl transferase subunit KCP2)
  • Length: 136  
  • Mass: 14679
  • Tissue specificity: Expressed in skin, heart, placental, liver, skeletal muscle, kidney, pancreas, keratinocytes and dermal fibroblasts. {ECO
• Sequence:

  MVVGTGTSLALSSLLSLLLFAGMQMYSRQLASTEWLTIQGGLLGSGLFVFSLTAFNNLENLVFGKGFQAKIFPEI
  LLCLLLALFASGLIHRVCVTTCFIFSMVGLYYINKISSTLYQAAAPVLTPAKVTGKSKKRN

• Structural information:
  • Interpro: IPR018614  
  • STRING: ENSP00000295682
• Other Databases: GeneCards:  KRTCAP2  Malacards:  KRTCAP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008250	oligosaccharyltransferase complex	IDA	is active in
GO:0008047	enzyme activator activity	IMP	molecular function
GO:0006487	protein N-linked glycosylation	IMP	biological process
GO:0042543	protein N-linked glycosylation via arginine	IBA	biological process
GO:0042543	protein N-linked glycosylation via arginine	IMP	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0008250	oligosaccharyltransferase complex	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0043085	positive regulation of catalytic activity	IEA	biological process
GO:0006486	protein glycosylation	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881