• Gene id: 199699

Gene Summary

• Gene Symbol: DAND5   Gene   UCSC   Ensembl
• Aliases: CER2, CERL2, CKTSF1B3, COCO, CRL2, DANTE, GREM3, SP1
• Gene name: DAN domain BMP antagonist family member 5
• Alternate names: DAN domain family member 5, DAN domain family member 5, BMP antagonist, DAN domain family, member 5, cerberus 2, cerberus-like 2, cerberus-like protein 2, cerl-2, cysteine knot superfamily 1, BMP antagonist 3, gremlin-3,
• Gene location: 19p13.13 (12969617: 12974752)     Exons: 2     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the BMP (bone morphogenic protein) antagonist family. Like BMPs, BMP antagonists contain cystine knots and typically form homo- and heterodimers. The CAN (cerberus and dan) subfamily of BMP antagonists, to which this gene bel
• OMIM: 300570

Protein Summary

• Protein general information: Q8N907  
  • Name: DAN domain family member 5 (Cerberus like protein 2) (Cerl 2) (Cysteine knot superfamily 1, BMP antagonist 3) (Gremlin 3)
  • Length: 189  
  • Mass: 20180
• Sequence:

  MLLGQLSTLLCLLSGALPTGSGRPEPQSPRPQSWAAANQTWALGPGALPPLVPASALGSWKAFLGLQKARQLGMG
  RLQRGQDEVAAVTLPLNPQEVIQGMCKAVPFVQVFSRPGCSAIRLRNHLCFGHCSSLYIPGSDPTPLVLCNSCMP
  ARKRWAPVVLWCLTGSSASRRRVKISTMLIEGCHCSPKA

• Structural information:
  • Protein Domains: (101..18-)
    (/note="CTCK"-)
  • Interpro: IPR016860  IPR029034  IPR004133  
  • STRING: ENSP00000323155
• Other Databases: GeneCards:  DAND5  Malacards:  DAND5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0016015	morphogen activity	IBA	molecular function
GO:0023019	signal transduction involved in regulation of gene expression	IBA	biological process
GO:0035582	sequestering of BMP in extracellular matrix	IBA	biological process
GO:0061371	determination of heart left/right asymmetry	IBA	biological process
GO:1900176	negative regulation of nodal signaling pathway involved in determination of lateral mesoderm left/right asymmetry	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:1900108	negative regulation of nodal signaling pathway	IEA	biological process
GO:0061371	determination of heart left/right asymmetry	IEA	biological process
GO:0038101	sequestering of nodal from receptor via nodal binding	IEA	biological process
GO:0017015	regulation of transforming growth factor beta receptor signaling pathway	IEA	biological process
GO:0016015	morphogen activity	IEA	molecular function
GO:0003283	atrial septum development	IEA	biological process
GO:0030514	negative regulation of BMP signaling pathway	IEA	biological process
GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway	IEA	biological process
GO:0007368	determination of left/right symmetry	IEA	biological process
GO:0003281	ventricular septum development	IEA	biological process
GO:0003140	determination of left/right asymmetry in lateral mesoderm	IEA	biological process
GO:0016015	morphogen activity	ISS	molecular function
GO:0003283	atrial septum development	ISS	biological process
GO:0005576	extracellular region	NAS	cellular component
GO:0038101	sequestering of nodal from receptor via nodal binding	ISS	biological process
GO:0061371	determination of heart left/right asymmetry	ISS	biological process
GO:1900108	negative regulation of nodal signaling pathway	ISS	biological process
GO:0003140	determination of left/right asymmetry in lateral mesoderm	ISS	biological process
GO:0003281	ventricular septum development	ISS	biological process
GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway	ISS	biological process
GO:0030514	negative regulation of BMP signaling pathway	ISS	biological process
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881