• Gene id: 199675

Gene Summary

• Gene Symbol: MCEMP1   Gene   UCSC   Ensembl
• Aliases: C19orf59
• Gene name: mast cell expressed membrane protein 1
• Alternate names: mast cell-expressed membrane protein 1, epididymis secretory sperm binding protein,
• Gene location: 19p13.2 (7677056: 7679832)     Exons: 7     NC_000019.10
• Gene summary(Entrez): This gene encodes a single-pass transmembrane protein. Based on its expression pattern, it is speculated to be involved in regulating mast cell differentiation or immune responses. [provided by RefSeq, Jul 2008]
• OMIM: 609565

Protein Summary

• Protein general information: Q8IX19  
  • Name: Mast cell expressed membrane protein 1
  • Length: 187  
  • Mass: 21229
  • Tissue specificity: Expressed specifically in mast cells. Found primarily in lung. {ECO
• Sequence:

  MEVEEIYKHQEVKMQAPAFRDKKQGVSAKNQGAHDPDYENITLAFKNQDHAKGGHSRPTSQVPAQCRPPSDSTQV
  PCWLYRAILSLYILLALAFVLCIILSAFIMVKNAEMSKELLGFKRELWNVSNSVQACEERQKRGWDSVQQSITMV
  RSKIDRLETTLAGIKNIDTKVQKILEVLQKMPQSSPQ

• Structural information:
  • Interpro: IPR038818  
  • STRING: ENSP00000329920
• Other Databases: GeneCards:  MCEMP1  Malacards:  MCEMP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0035579	specific granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0070821	tertiary granule membrane	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881