• Gene id: 1996

Gene Summary

• Gene Symbol: ELAVL4   Gene   UCSC   Ensembl
• Aliases: HUD, PNEM
• Gene name: ELAV like RNA binding protein 4
• Alternate names: ELAV-like protein 4, ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D), ELAV like neuron-specific RNA binding protein 4, Hu antigen D, paraneoplastic encephalomyelitis antigen HuD,
• Gene location: 1p33-p32.3 (50048054: 50203771)     Exons: 17     NC_000001.11
• OMIM: 168360

Protein Summary

• Protein general information: P26378  
  • Name: ELAV like protein 4 (Hu antigen D) (HuD) (Paraneoplastic encephalomyelitis antigen HuD)
  • Length: 385  
  • Mass: 42398
  • Tissue specificity: Expressed in pancreatic beta cells (at protein level) (PubMed
• Sequence:

  MEWNGLKMIISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIG
  EIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQ
  KELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPSGATEPITVKFANNPSQKSSQA
  LLSQLYQSPNRRYPGPLHHQAQRFRLDNLLNMAYGVKRLMSGPVPPSACPPRFSPITIDGMTSLVGMNIPGHTGT
  GWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQV
  SFKTNKAHKS

• Structural information:
  • Protein Domains: (51..12-)
    (/note="RRM-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (137..21-)
    (/note="RRM-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (302..38-)
    (/note="RRM-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR006548  IPR034775  IPR034918  IPR002343  IPR012677   IPR035979  IPR000504  
  • Prosite: PS50102
  • CDD: cd12650 cd12656
  • PDB: 1FXL 1G2E
  • PDBsum: 1FXL 1G2E
  • STRING: ENSP00000349594
• Other Databases: GeneCards:  ELAVL4  Malacards:  ELAVL4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1990904	ribonucleoprotein complex	IEA	cellular component
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0008380	RNA splicing	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0003730	mRNA 3'-UTR binding	TAS	molecular function
GO:0006397	mRNA processing	TAS	biological process
GO:0030426	growth cone	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0043204	perikaryon	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0035925	mRNA 3'-UTR AU-rich region binding	IDA	molecular function
GO:0035925	mRNA 3'-UTR AU-rich region binding	IDA	molecular function
GO:0035925	mRNA 3'-UTR AU-rich region binding	IDA	molecular function
GO:0097158	pre-mRNA intronic pyrimidine-rich binding	IDA	molecular function
GO:1905870	positive regulation of 3'-UTR-mediated mRNA stabilization	IDA	biological process
GO:0003730	mRNA 3'-UTR binding	IDA	molecular function
GO:0008143	poly(A) binding	IDA	molecular function
GO:0003730	mRNA 3'-UTR binding	IDA	molecular function
GO:0006396	RNA processing	IDA	biological process
GO:0070935	3'-UTR-mediated mRNA stabilization	IDA	biological process
GO:0030425	dendrite	ISS	cellular component
GO:0030424	axon	ISS	cellular component
GO:0005737	cytoplasm	ISS	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray