• Gene id: 199221

Gene Summary

• Gene Symbol: DZIP1L   Gene   UCSC   Ensembl
• Aliases: DZIP2, PKD5
• Gene name: DAZ interacting zinc finger protein 1 like
• Alternate names: zinc finger protein DZIP1L, DAZ interacting protein 1-like, DAZ-interacting protein 1-like protein,
• Gene location: 3q22.3 (138115861: 138061989)     Exons: 25     NC_000003.12
• OMIM: 617570

Protein Summary

• Protein general information: Q8IYY4  
  • Name: Zinc finger protein DZIP1L (DAZ interacting protein 1 like protein)
  • Length: 767  
  • Mass: 86848
• Sequence:

  MQSPAATAEGLSGPLFGAYTFPTFKFQPRHDSMDWRRISTLDVDRVARELDVATLQENIAGITFCNLDREVCSRC
  GQPVDPALLKVLRLAQLIIEYLLHCQDCLSASVAQLEARLQTSLGQQQRGQQELGRQADELKGVREESRRRRKMI
  STLQQLLMQTGTHSYHTCHLCDKTFMNATFLRGHIQRRHAGVAEGGKQKKQEQPVEEVLEELRAKLKWTQGELEA
  QREAERQRQLQEAELIHQREIEAKKEFDKWKEQEWTKLYGEIDKLKKLFWDEFKNVAKQNSTLEEKLRALQSHSV
  MESKLGSLRDEESEEWLRQARELQALREKTEIQKTEWKRKVKELHEEHMAEKKELQEENQRLQASLSQDQKKAAA
  QSQCQISTLRAQLQEQARIIASQEEMIQSLSLRKVEGIHKVPKAVDTEEDSPEEEMEDSQDEQHKVLAALRRNPT
  LLKHFRPILEDTLEEKLESMGIRKDAKGISIQTLRHLESLLRVQREQKARKFSEFLSLRGKLVKEVTSRAKERQE
  NGAVVSQPDGQPSVKSQQSTLVTREAQPKTRTLQVALPSTPAEPPPPTRQSHGSHGSSLTQVSAPAPRPGLHGPS
  STPPSSGPGMSTPPFSSEEDSEGDRVQRVSLQPPKVPSRMVPRPKDDWDWSDTETSEENAQPPGQGSGTLVQSMV
  KNLEKQLEAPAKKPAGGVSLFFMPNAGPQRAATPGRKPQLSEDESDLEISSLEDLPLDLDQREKPKPLSRSKLPE
  KFGTGPQSSGQPRVPAW

• Structural information:
  • Interpro: IPR032714  IPR013087  
  • Prosite: PS00028 PS50157
  • STRING: ENSP00000332148
• Other Databases: GeneCards:  DZIP1L  Malacards:  DZIP1L

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0060271	cilium assembly	IBA	biological process
GO:0036064	ciliary basal body	IBA	cellular component
GO:0036064	ciliary basal body	IDA	cellular component
GO:0005814	centriole	IDA	cellular component
GO:0060271	cilium assembly	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0032880	regulation of protein localization	IMP	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005929	cilium	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005930	axoneme	IEA	cellular component
GO:0036064	ciliary basal body	IEA	cellular component
GO:0060271	cilium assembly	IEA	biological process
GO:1905349	ciliary transition zone assembly	IEA	biological process
GO:0005814	centriole	IEA	cellular component
GO:0007224	smoothened signaling pathway	IEA	biological process
GO:0021532	neural tube patterning	IEA	biological process
GO:0033365	protein localization to organelle	IEA	biological process
GO:0033504	floor plate development	IEA	biological process
GO:0061512	protein localization to cilium	IEA	biological process
GO:0036064	ciliary basal body	IDA	cellular component
GO:0005814	centriole	IDA	colocalizes with
GO:0060271	cilium assembly	IMP	biological process
GO:0005814	centriole	IEA	cellular component

Diseases

Associated diseases	References
Polycystic kidney disease	KEGG:H00542
Polycystic kidney disease	KEGG:H00542
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881