• Gene id: 1984

Gene Summary

• Gene Symbol: EIF5A   Gene   UCSC   Ensembl
• Aliases: EIF-5A, EIF5A1, eIF-4D, eIF5AI
• Gene name: eukaryotic translation initiation factor 5A
• Alternate names: eukaryotic translation initiation factor 5A-1, eukaryotic initiation factor 5A, rev-binding factor,
• Gene location: 17p13.1 (67951917: 68237031)     Exons: 41     NC_000008.11
• OMIM: 600187

Protein Summary

• Protein general information: P63241  
  • Name: Eukaryotic translation initiation factor 5A 1 (eIF 5A 1) (eIF 5A1) (Eukaryotic initiation factor 5A isoform 1) (eIF 5A) (Rev binding factor) (eIF 4D)
  • Length: 154  
  • Mass: 16832
  • Tissue specificity: Expressed in umbilical vein endothelial cells and several cancer cell lines (at protein level). {ECO
• Sequence:

  MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPS
  THNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIK
  AMAK

• Structural information:
  • Interpro: IPR001884  IPR012340  IPR014722  IPR019769  IPR020189   IPR008991  
  • Prosite: PS00302
  • PDB: 1FH4 3CPF 5DLQ
  • PDBsum: 1FH4 3CPF 5DLQ
  • STRING: ENSP00000336702
• Other Databases: GeneCards:  EIF5A  Malacards:  EIF5A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003746	translation elongation factor activity	IBA	molecular function
GO:0045901	positive regulation of translational elongation	IBA	biological process
GO:0003746	translation elongation factor activity	IEA	molecular function
GO:0043022	ribosome binding	IEA	molecular function
GO:0045901	positive regulation of translational elongation	IEA	biological process
GO:0045905	positive regulation of translational termination	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0051028	mRNA transport	IEA	biological process
GO:0006414	translational elongation	IEA	biological process
GO:0006412	translation	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0003746	translation elongation factor activity	IEA	molecular function
GO:0005643	nuclear pore	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0015031	protein transport	IEA	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005643	nuclear pore	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005643	nuclear pore	IDA	cellular component
GO:0005642	annulate lamellae	IDA	cellular component
GO:0006915	apoptotic process	IDA	biological process
GO:0006913	nucleocytoplasmic transport	IDA	NOT|biological process
GO:0005634	nucleus	IDA	cellular component
GO:0017070	U6 snRNA binding	IDA	molecular function
GO:0006915	apoptotic process	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0003723	RNA binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	HDA	cellular component
GO:0045901	positive regulation of translational elongation	ISS	biological process
GO:0006611	protein export from nucleus	IMP	biological process
GO:0047485	protein N-terminus binding	IPI	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0006913	nucleocytoplasmic transport	IMP	biological process
GO:0006406	mRNA export from nucleus	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008284	positive regulation of cell population proliferation	IGI	biological process
GO:0003746	translation elongation factor activity	ISS	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881