• Gene id: 1983

Gene Summary

• Gene Symbol: EIF5   Gene   UCSC   Ensembl
• Aliases: EIF-5, EIF-5A
• Gene name: eukaryotic translation initiation factor 5
• Alternate names: eukaryotic translation initiation factor 5,
• Gene location: 14q32.32 (103334236: 103345024)     Exons: 13     NC_000014.9
• Gene summary(Entrez): Eukaryotic translation initiation factor-5 (EIF5) interacts with the 40S initiation complex to promote hydrolysis of bound GTP with concomitant joining of the 60S ribosomal subunit to the 40S initiation complex. The resulting functional 80S ribosomal init
• OMIM: 601710

Protein Summary

• Protein general information: P55010  
  • Name: Eukaryotic translation initiation factor 5 (eIF 5)
  • Length: 431  
  • Mass: 49223
• Sequence:

  MSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYI
  VNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTFILKNPPENSD
  SGTGKKEKEKKNRKGKDKENGSVSSSETPPPPPPPNEINPPPHTMEEEEDDDWGEDTTEEAQRRRMDEISDHAKV
  LTLSDDLERTIEERVNILFDFVKKKKEEGVIDSSDKEIVAEAERLDVKAMGPLVLTEVLFNEKIREQIKKYRRHF
  LRFCHNNKKAQRYLLHGLECVVAMHQAQLISKIPHILKEMYDADLLEEEVIISWSEKASKKYVSKELAKEIRVKA
  EPFIKWLKEAEEESSGGEEEDEDENIEVVYSKAASVPKVETVKSDNKDDDIDIDAI

• Structural information:
  • Protein Domains: (233..39-)
    (/note="W2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00695"-)
  • Interpro: IPR016024  IPR016021  IPR002735  IPR016189  IPR016190   IPR003307  
  • Prosite: PS51363
  • PDB: 2E9H 2G2K 2IU1
  • PDBsum: 2E9H 2G2K 2IU1
  • STRING: ENSP00000216554
• Other Databases: GeneCards:  EIF5  Malacards:  EIF5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006446	regulation of translational initiation	IDA	biological process
GO:0003743	translation initiation factor activity	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0071074	eukaryotic initiation factor eIF2 binding	IBA	molecular function
GO:0001731	formation of translation preinitiation complex	IBA	biological process
GO:0001732	formation of cytoplasmic translation initiation complex	IBA	biological process
GO:0005092	GDP-dissociation inhibitor activity	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003743	translation initiation factor activity	IEA	molecular function
GO:0006413	translational initiation	IEA	biological process
GO:0003743	translation initiation factor activity	IEA	molecular function
GO:0006412	translation	IEA	biological process
GO:0005525	GTP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0006413	translational initiation	IEA	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0090630	activation of GTPase activity	IEA	biological process
GO:0071074	eukaryotic initiation factor eIF2 binding	IEA	molecular function
GO:0003743	translation initiation factor activity	IEA	molecular function
GO:0001731	formation of translation preinitiation complex	IEA	biological process
GO:0045296	cadherin binding	HDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	NOT|cellular component
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03013	RNA transport

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq