• Gene id: 1982

Gene Summary

• Gene Symbol: EIF4G2   Gene   UCSC   Ensembl
• Aliases: AAG1, DAP5, NAT1, P97
• Gene name: eukaryotic translation initiation factor 4 gamma 2
• Alternate names: eukaryotic translation initiation factor 4 gamma 2, DAP-5, aging-associated protein 1, death-associated protein 5, eIF-4-gamma 2, eIF-4G 2, eIF4G 2, eukaryotic translation initiation factor 4G-like 1,
• Gene location: 11p15.4 (109614204: 109542796)     Exons: 13     NC_000002.12
• Gene summary(Entrez): Translation initiation is mediated by specific recognition of the cap structure by eukaryotic translation initiation factor 4F (eIF4F), which is a cap binding protein complex that consists of three subunits: eIF4A, eIF4E and eIF4G. The protein encoded by
• OMIM: 602325

Protein Summary

• Protein general information: P78344  
  • Name: Eukaryotic translation initiation factor 4 gamma 2 (eIF 4 gamma 2) (eIF 4G 2) (eIF4G 2) (Death associated protein 5) (DAP 5) (p97)
  • Length: 907  
  • Mass: 102362
  • Tissue specificity: Ubiquitously expressed in all adult tissues examined, with high levels in skeletal muscle and heart. Also expressed in fetal brain, lung, liver and kidney. {ECO
• Sequence:

  MESAIAEGGASRFSASSGGGGSRGAPQHYPKTAGNSEFLGKTPGQNAQKWIPARSTRRDDNSAANNSANEKERHD
  AIFRKVRGILNKLTPEKFDKLCLELLNVGVESKLILKGVILLIVDKALEEPKYSSLYAQLCLRLAEDAPNFDGPA
  AEGQPGQKQSTTFRRLLISKLQDEFENRTRNVDVYDKRENPLLPEEEEQRAIAKIKMLGNIKFIGELGKLDLIHE
  SILHKCIKTLLEKKKRVQLKDMGEDLECLCQIMRTVGPRLDHERAKSLMDQYFARMCSLMLSKELPARIRFLLQD
  TVELREHHWVPRKAFLDNGPKTINQIRQDAVKDLGVFIPAPMAQGMRSDFFLEGPFMPPRMKMDRDPLGGLADMF
  GQMPGSGIGTGPGVIQDRFSPTMGRHRSNQLFNGHGGHIMPPTQSQFGEMGGKFMKSQGLSQLYHNQSQGLLSQL
  QGQSKDMPPRFSKKGQLNADEISLRPAQSFLMNKNQVPKLQPQITMIPPSAQPPRTQTPPLGQTPQLGLKTNPPL
  IQEKPAKTSKKPPPSKEELLKLTETVVTEYLNSGNANEAVNGVREMRAPKHFLPEMLSKVIILSLDRSDEDKEKA
  SSLISLLKQEGIATSDNFMQAFLNVLDQCPKLEVDIPLVKSYLAQFAARAIISELVSISELAQPLESGTHFPLFL
  LCLQQLAKLQDREWLTELFQQSKVNMQKMLPEIDQNKDRMLEILEGKGLSFLFPLLKLEKELLKQIKLDPSPQTI
  YKWIKDNISPKLHVDKGFVNILMTSFLQYISSEVNPPSDETDSSSAPSKEQLEQEKQLLLSFKPVMQKFLHDHVD
  LQVSALYALQVHCYNSNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQWLTWLETAEEE
  ESEEEAD

• Structural information:
  • Protein Domains: (78..30-)
    (/note="MIF4G-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00698-)
    (543..66-)
    (/note="MI-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00698-)
    (720..90-)
    (/note="W2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00695"-)
  • Interpro: IPR016024  IPR003891  IPR016021  IPR003890  IPR003307  
  • Prosite: PS51366 PS51363
  • PDB: 3D3M 3L6A 4IUL
  • PDBsum: 3D3M 3L6A 4IUL
  • DIP: 31366
  • STRING: ENSP00000433664
• Other Databases: GeneCards:  EIF4G2  Malacards:  EIF4G2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0034645	cellular macromolecule biosynthetic process	IGI	biological process
GO:0010507	negative regulation of autophagy	IMP	biological process
GO:0030307	positive regulation of cell growth	IMP	biological process
GO:0003743	translation initiation factor activity	IBA	molecular function
GO:0003729	mRNA binding	IBA	molecular function
GO:0016281	eukaryotic translation initiation factor 4F complex	IBA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0003743	translation initiation factor activity	IEA	molecular function
GO:0006417	regulation of translation	IEA	biological process
GO:0006412	translation	IEA	biological process
GO:0006413	translational initiation	IEA	biological process
GO:0008135	translation factor activity, RNA binding	TAS	molecular function
GO:0008219	cell death	TAS	biological process
GO:0007050	cell cycle arrest	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045296	cadherin binding	HDA	molecular function
GO:0005912	adherens junction	HDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0006446	regulation of translational initiation	IDA	biological process
GO:0008135	translation factor activity, RNA binding	IDA	molecular function
GO:0003743	translation initiation factor activity	IDA	molecular function
GO:0016281	eukaryotic translation initiation factor 4F complex	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03013	RNA transport
hsa05416	Viral myocarditis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881