• Gene id: 1979

Gene Summary

• Gene Symbol: EIF4EBP2   Gene   UCSC   Ensembl
• Aliases: 4EBP2, PHASII
• Gene name: eukaryotic translation initiation factor 4E binding protein 2
• Alternate names: eukaryotic translation initiation factor 4E-binding protein 2, 4E-BP2, eIF4E-binding protein 2, phosphorylated, heat and acid stable regulated by insulin protein II,
• Gene location: 10q22.1 (62165731: 62163534)     Exons: 3     NC_000015.10
• Gene summary(Entrez): This gene encodes a member of the eukaryotic translation initiation factor 4E binding protein family. The gene products of this family bind eIF4E and inhibit translation initiation. However, insulin and other growth factors can release this inhibition via
• OMIM: 602224

Protein Summary

• Protein general information: Q13542  
  • Name: Eukaryotic translation initiation factor 4E binding protein 2 (4E BP2) (eIF4E binding protein 2)
  • Length: 120  
  • Mass: 12939
• Sequence:

  MSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQTPPCHL
  PNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI

• Structural information:
  • Interpro: IPR008606  
  • PDB: 2MX4 3AM7
  • PDBsum: 2MX4 3AM7
  • DIP: 36572
  • STRING: ENSP00000362314
• Other Databases: GeneCards:  EIF4EBP2  Malacards:  EIF4EBP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045947	negative regulation of translational initiation	IBA	biological process
GO:0008190	eukaryotic initiation factor 4E binding	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0030371	translation repressor activity	ISS	molecular function
GO:0048167	regulation of synaptic plasticity	ISS	biological process
GO:0045947	negative regulation of translational initiation	ISS	biological process
GO:0035176	social behavior	ISS	biological process
GO:0007613	memory	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0008190	eukaryotic initiation factor 4E binding	ISS	molecular function
GO:0050804	modulation of chemical synaptic transmission	ISS	biological process
GO:0031929	TOR signaling	ISS	biological process
GO:0045947	negative regulation of translational initiation	IEA	biological process
GO:0008190	eukaryotic initiation factor 4E binding	IEA	molecular function
GO:0017148	negative regulation of translation	IEA	biological process
GO:0006417	regulation of translation	IEA	biological process
GO:0006412	translation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007613	memory	IEA	biological process
GO:0008286	insulin receptor signaling pathway	IEA	biological process
GO:0019933	cAMP-mediated signaling	IEA	biological process
GO:0030371	translation repressor activity	IEA	molecular function
GO:0035176	social behavior	IEA	biological process
GO:0045947	negative regulation of translational initiation	IEA	biological process
GO:0048167	regulation of synaptic plasticity	IEA	biological process
GO:0098794	postsynapse	IEA	cellular component
GO:0008190	eukaryotic initiation factor 4E binding	IEA	molecular function
GO:0031929	TOR signaling	IEA	biological process
GO:0050804	modulation of chemical synaptic transmission	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa03013	RNA transport
hsa04213	Longevity regulating pathway - multiple species

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881