• Gene id: 1978

Gene Summary

• Gene Symbol: EIF4EBP1   Gene   UCSC   Ensembl
• Aliases: 4E-BP1, 4EBP1, BP-1, PHAS-I
• Gene name: eukaryotic translation initiation factor 4E binding protein 1
• Alternate names: eukaryotic translation initiation factor 4E-binding protein 1, eIF4E-binding protein 1, phosphorylated heat- and acid-stable protein regulated by insulin 1,
• Gene location: 8p11.23 (38030533: 38060364)     Exons: 3     NC_000008.11
• Gene summary(Entrez): This gene encodes one member of a family of translation repressor proteins. The protein directly interacts with eukaryotic translation initiation factor 4E (eIF4E), which is a limiting component of the multisubunit complex that recruits 40S ribosomal subu
• OMIM: 602223

Protein Summary

• Protein general information: Q13541  
  • Name: Eukaryotic translation initiation factor 4E binding protein 1 (4E BP1) (eIF4E binding protein 1) (Phosphorylated heat and acid stable protein regulated by insulin 1) (PHAS I)
  • Length: 118  
  • Mass: 12580
• Sequence:

  MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDL
  PTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI

• Structural information:
  • Interpro: IPR008606  IPR037582  
  • PDB: 1EJ4 1EJH 1WKW 2JGB 2JGC 2V8W 2V8X 2V8Y 3HXG 3HXI 3M93 3M94 3U7X 4UED 5BXV 5EKV 5NVN 5WBJ 6BCU 6BCX
  • PDBsum: 1EJ4 1EJH 1WKW 2JGB 2JGC 2V8W 2V8X 2V8Y 3HXG 3HXI 3M93 3M94 3U7X 4UED 5BXV 5EKV 5NVN 5WBJ 6BCU 6BCX
  • DIP: 30944
  • STRING: ENSP00000340691
• Other Databases: GeneCards:  EIF4EBP1  Malacards:  EIF4EBP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045947	negative regulation of translational initiation	IEA	biological process
GO:0008190	eukaryotic initiation factor 4E binding	IEA	molecular function
GO:0006417	regulation of translation	IEA	biological process
GO:0017148	negative regulation of translation	IEA	biological process
GO:0045947	negative regulation of translational initiation	IBA	biological process
GO:0008190	eukaryotic initiation factor 4E binding	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0008190	eukaryotic initiation factor 4E binding	IDA	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008286	insulin receptor signaling pathway	IEA	biological process
GO:0045947	negative regulation of translational initiation	IEA	biological process
GO:0002931	response to ischemia	IEA	biological process
GO:0031333	negative regulation of protein-containing complex assembly	IEA	biological process
GO:0031369	translation initiation factor binding	IEA	molecular function
GO:0032991	protein-containing complex	IEA	cellular component
GO:0045471	response to ethanol	IEA	biological process
GO:0045947	negative regulation of translational initiation	IEA	biological process
GO:0071456	cellular response to hypoxia	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0002192	IRES-dependent translational initiation of linear mRNA	IEA	biological process
GO:0008190	eukaryotic initiation factor 4E binding	IEA	molecular function
GO:0071549	cellular response to dexamethasone stimulus	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0008190	eukaryotic initiation factor 4E binding	IEA	molecular function
GO:0030324	lung development	IEA	biological process
GO:0051721	protein phosphatase 2A binding	IEA	molecular function
GO:0099524	postsynaptic cytosol	IEA	cellular component
GO:1990928	response to amino acid starvation	IEA	biological process
GO:0045947	negative regulation of translational initiation	IDA	biological process
GO:0030371	translation repressor activity	IDA	molecular function
GO:0031929	TOR signaling	IDA	biological process
GO:0031929	TOR signaling	IDA	biological process
GO:0045931	positive regulation of mitotic cell cycle	IMP	biological process
GO:0000082	G1/S transition of mitotic cell cycle	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05168	Herpes simplex virus 1 infection
hsa04151	PI3K-Akt signaling pathway
hsa05165	Human papillomavirus infection
hsa05163	Human cytomegalovirus infection
hsa03013	RNA transport
hsa04150	mTOR signaling pathway
hsa04910	Insulin signaling pathway
hsa04218	Cellular senescence
hsa04152	AMPK signaling pathway
hsa05231	Choline metabolism in cancer
hsa04066	HIF-1 signaling pathway
hsa04012	ErbB signaling pathway
hsa04211	Longevity regulating pathway
hsa01521	EGFR tyrosine kinase inhibitor resistance
hsa05221	Acute myeloid leukemia
P06959	CCKR signaling map
P06959	CCKR signaling map

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881