• Gene id: 1975

Gene Summary

• Gene Symbol: EIF4B   Gene   UCSC   Ensembl
• Aliases: EIF-4B, PRO1843
• Gene name: eukaryotic translation initiation factor 4B
• Alternate names: eukaryotic translation initiation factor 4B,
• Gene location: 12q13.13 (53006455: 53042214)     Exons: 8     NC_000012.12
• OMIM: 603928

Protein Summary

• Protein general information: P23588  
  • Name: Eukaryotic translation initiation factor 4B (eIF 4B)
  • Length: 611  
  • Mass: 69151
• Sequence:

  MAASAKKKNKKGKTISLTDFLAEDGGTGGGSTYVSKPVSWADETDDLEGDVSTTWHSNDDDVYRAPPIDRSILPT
  APRAAREPNIDRSRLPKSPPYTAFLGNLPYDVTEESIKEFFRGLNISAVRLPREPSNPERLKGFGYAEFEDLDSL
  LSALSLNEESLGNRRIRVDVADQAQDKDRDDRSFGRDRNRDSDKTDTDWRARPATDSFDDYPPRRGDDSFGDKYR
  DRYDSDRYRDGYRDGYRDGPRRDMDRYGGRDRYDDRGSRDYDRGYDSRIGSGRRAFGSGYRRDDDYRGGGDRYED
  RYDRRDDRSWSSRDDYSRDDYRRDDRGPPQRPKLNLKPRSTPKEDDSSASTSQSTRAASIFGGAKPVDTAARERE
  VEERLQKEQEKLQRQLDEPKLERRPRERHPSWRSEETQERERSRTGSESSQTGTSTTSSRNARRRESEKSLENET
  LNKEEDCHSPTSKPPKPDQPLKVMPAPPPKENAWVKRSSNPPARSQSSDTEQQSPTSGGGKVAPAQPSEEGPGRK
  DENKVDGMNAPKGQTGNSSRGPGDGGNRDHWKESDRKDGKKDQDSRSAPEPKKPEENPASKFSSASKYAALSVDG
  EDENEGEDYAE

• Structural information:
  • Protein Domains: (96..17-)
    (/note="RRM-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR033107  IPR012677  IPR035979  IPR000504  
  • Prosite: PS50102
  • PDB: 1WI8 2J76 6FEC
  • PDBsum: 1WI8 2J76 6FEC
  • STRING: ENSP00000388806
• Other Databases: GeneCards:  EIF4B  Malacards:  EIF4B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005844	polysome	IBA	cellular component
GO:0033592	RNA strand annealing activity	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0097010	eukaryotic translation initiation factor 4F complex assembly	IEA	biological process
GO:0003743	translation initiation factor activity	IEA	molecular function
GO:0006412	translation	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0006413	translational initiation	IEA	biological process
GO:0003743	translation initiation factor activity	TAS	molecular function
GO:0003723	RNA binding	TAS	molecular function
GO:0016281	eukaryotic translation initiation factor 4F complex	TAS	cellular component
GO:0006446	regulation of translational initiation	TAS	biological process
GO:0006413	translational initiation	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa05205	Proteoglycans in cancer
hsa03013	RNA transport
hsa04150	mTOR signaling pathway

Diseases

Associated diseases	References
Autism spectrum disorder	PMID:25627160
Major depressive disorder	PMID:21635931
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray