• Gene id: 1974

Gene Summary

• Gene Symbol: EIF4A2   Gene   UCSC   Ensembl
• Aliases: BM-010, DDX2B, EIF4A, EIF4F, eIF-4A-II, eIF4A-II
• Gene name: eukaryotic translation initiation factor 4A2
• Alternate names: eukaryotic initiation factor 4A-II, ATP-dependent RNA helicase eIF4A-2,
• Gene location: 3q27.3 (186783576: 186789896)     Exons: 11     NC_000003.12
• OMIM: 601102

Protein Summary

• Protein general information: Q14240  
  • Name: Eukaryotic initiation factor 4A II (eIF 4A II) (eIF4A II) (EC 3.6.4.13) (ATP dependent RNA helicase eIF4A 2)
  • Length: 407  
  • Mass: 46402
• Sequence:

  MSGGSADYNREHGGPEGMDPDGVIESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIA
  QAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNVRNEMQKLQA
  EAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVT
  KKFMRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTV
  SALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAIN
  FVTEEDKRILRDIETFYNTTVEEMPMNVADLI

• Structural information:
  • Protein Domains: (64..23-)
    (/note="Helicase-ATP-binding)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00541-)
    (246..40-)
    (/note="Helicase-C-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00542"-)
  • Interpro: IPR011545  IPR014001  IPR001650  IPR027417  IPR000629   IPR014014  
  • Prosite: PS00039 PS51192 PS51194 PS51195
  • PDB: 3BOR
  • PDBsum: 3BOR
  • STRING: ENSP00000326381
• Other Databases: GeneCards:  EIF4A2  Malacards:  EIF4A2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003743	translation initiation factor activity	IBA	molecular function
GO:0002183	cytoplasmic translational initiation	IBA	biological process
GO:0003724	RNA helicase activity	IBA	molecular function
GO:0003723	RNA binding	IBA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0004386	helicase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0003743	translation initiation factor activity	IEA	molecular function
GO:0006412	translation	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0006413	translational initiation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0003743	translation initiation factor activity	TAS	molecular function
GO:0004386	helicase activity	TAS	molecular function
GO:0016281	eukaryotic translation initiation factor 4F complex	TAS	cellular component
GO:0006446	regulation of translational initiation	TAS	biological process
GO:0003724	RNA helicase activity	IEA	molecular function
GO:0016887	ATPase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:1900260	negative regulation of RNA-directed 5'-3' RNA polymerase activity	IDA	biological process
GO:0006413	translational initiation	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1990830	cellular response to leukemia inhibitory factor	IEA	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03013	RNA transport

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881