• Gene id: 197257

Gene Summary

• Gene Symbol: LDHD   Gene   UCSC   Ensembl
• Aliases: DLACD, DLD
• Gene name: lactate dehydrogenase D
• Alternate names: probable D-lactate dehydrogenase, mitochondrial, D-lactate dehydrogenase,
• Gene location: 16q23.1 (75116794: 75111859)     Exons: 10     NC_000016.10
• Gene summary(Entrez): The protein encoded by this gene belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family. The similar protein in yeast has both D-lactate and D-glycerate dehydrogenase activities. Alternative splicing occurs at this locus and two transcript va
• OMIM: 605155

Protein Summary

• Protein general information: Q86WU2  
  • Name: Probable D lactate dehydrogenase, mitochondrial (DLD) (Lactate dehydrogenase D) (EC 1.1.2.4)
  • Length: 507  
  • Mass: 54871
  • Tissue specificity: Expressed moderately in heart and liver and at lower levels in skeletal muscle and kidney. {ECO
• Sequence:

  MARLLRSATWELFPWRGYCSQKAKGELCRDFVEALKAVVGGSHVSTAAVVREQHGRDESVHRCEPPDAVVWPQNV
  EQVSRLAALCYRQGVPIIPFGTGTGLEGGVCAVQGGVCVNLTHMDRILELNQEDFSVVVEPGVTRKALNAHLRDS
  GLWFPVDPGADASLCGMAATGASGTNAVRYGTMRDNVLNLEVVLPDGRLLHTAGRGRHFRFGFWPEIPHHTAWYS
  PCVSLGRRKSAAGYNLTGLFVGSEGTLGLITATTLRLHPAPEATVAATCAFPSVQAAVDSTVHILQAAVPVARIE
  FLDEVMMDACNRYSKLNCLVAPTLFLEFHGSQQALEEQLQRTEEIVQQNGASDFSWAKEAEERSRLWTARHNAWY
  AALATRPGCKGYSTDVCVPISRLPEIVVQTKEDLNASGLTGSIVGHVGDGNFHCILLVNPDDAEELGRVKAFAEQ
  LGRRALALHGTCTGEHGIGMGKRQLLQEEVGAVGVETMRQLKAVLDPQGLMNPGKVL

• Structural information:
  • Protein Domains: (62..26-)
    (/note="FAD-binding-PCMH-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00718"-)
  • Interpro: IPR016166  IPR036318  IPR016164  IPR004113  IPR006094   IPR016171  
  • Prosite: PS51387
  • STRING: ENSP00000300051
• Other Databases: GeneCards:  LDHD  Malacards:  LDHD

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1903457	lactate catabolic process	IBA	biological process
GO:0050660	flavin adenine dinucleotide binding	IBA	molecular function
GO:0008720	D-lactate dehydrogenase activity	IBA	molecular function
GO:0004458	D-lactate dehydrogenase (cytochrome) activity	IBA	molecular function
GO:0005739	mitochondrion	IBA	cellular component
GO:1903457	lactate catabolic process	IMP	biological process
GO:0050660	flavin adenine dinucleotide binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0071949	FAD binding	IEA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0004458	D-lactate dehydrogenase (cytochrome) activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00620	Pyruvate metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq