• Gene id: 197

Gene Summary

• Gene Symbol: AHSG   Gene   UCSC   Ensembl
• Aliases: A2HS, AHS, APMR1, FETUA, HSGA
• Gene name: alpha 2-HS glycoprotein
• Alternate names: alpha-2-HS-glycoprotein, alpha-2-Z-globulin, ba-alpha-2-glycoprotein, fetuin-A,
• Gene location: 3q27.3 (186613059: 186621317)     Exons: 7     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene is a negatively-charged serum glycoprotein that is synthesized by hepatocytes. The encoded protein consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in
• OMIM: 148760

Protein Summary

• Protein general information: P02765  
  • Name: Alpha 2 HS glycoprotein (Alpha 2 Z globulin) (Ba alpha 2 glycoprotein) (Fetuin A) [Cleaved into: Alpha 2 HS glycoprotein chain A; Alpha 2 HS glycoprotein chain B]
  • Length: 367  
  • Mass: 39341
  • Tissue specificity: Synthesized in liver and selectively concentrated in bone matrix. Secreted in plasma. It is also found in dentin in much higher quantities than other plasma proteins.
• Sequence:

  MKSLVLLLCLAQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSG
  ELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCP
  LLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEK
  QYGFCKATLSEKLGGAEVAVTCMVFQTQPVSSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVL
  LAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKV

• Structural information:
  • Protein Domains: (27..13-)
    1 (/note="Cystatin-fetuin-A-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00861-)
    (144..25-)
    2 (/note="Cystatin-fetuin-A-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00861"-)
  • Interpro: IPR000010  IPR025760  IPR001363  
  • Prosite: PS51529 PS01254 PS01255
  • CDD: cd00042
  • STRING: ENSP00000393887
• Other Databases: GeneCards:  AHSG  Malacards:  AHSG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0010951	negative regulation of endopeptidase activity	IBA	biological process
GO:0031012	extracellular matrix	IBA	cellular component
GO:0005576	extracellular region	IBA	cellular component
GO:0004866	endopeptidase inhibitor activity	IBA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0004869	cysteine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0030500	regulation of bone mineralization	IEA	biological process
GO:0002576	platelet degranulation	TAS	biological process
GO:0031093	platelet alpha granule lumen	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0034774	secretory granule lumen	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005576	extracellular region	HDA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0033673	negative regulation of kinase activity	IEA	biological process
GO:0006953	acute-phase response	IDA	biological process
GO:0050766	positive regulation of phagocytosis	IDA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005615	extracellular space	HDA	cellular component
GO:0005576	extracellular region	NAS	cellular component
GO:0001501	skeletal system development	NAS	biological process
GO:0030500	regulation of bone mineralization	NAS	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0050727	regulation of inflammatory response	IMP	biological process
GO:0030502	negative regulation of bone mineralization	ISS	biological process
GO:0006907	pinocytosis	NAS	biological process
GO:0005615	extracellular space	NAS	cellular component
GO:0072562	blood microparticle	HDA	cellular component
GO:0046627	negative regulation of insulin receptor signaling pathway	NAS	biological process
GO:0019210	kinase inhibitor activity	NAS	molecular function

Diseases

Associated diseases	References
Alopecia-mental retardation syndrome	KEGG:H02303
Alopecia-mental retardation syndrome	KEGG:H02303
Gestational diabetes	PMID:12153747
Coronary artery disease	PMID:17062776
Myocardial infarction	PMID:19029462
type 2 diabetes mellitus	PMID:18633113
type 2 diabetes mellitus	PMID:18316360
obesity	PMID:19228823
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray