• Gene id: 1969

Gene Summary

• Gene Symbol: EPHA2   Gene   UCSC   Ensembl
• Aliases: ARCC2, CTPA, CTPP1, CTRCT6, ECK
• Gene name: EPH receptor A2
• Alternate names: ephrin type-A receptor 2, epithelial cell receptor protein tyrosine kinase, soluble EPHA2 variant 1, tyrosine-protein kinase receptor ECK,
• Gene location: 1p36.13 (16156103: 16124336)     Exons: 18     NC_000001.11
• Gene summary(Entrez): This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically ha
• OMIM: 605492

Protein Summary

• Protein general information: P29317  
  • Name: Ephrin type A receptor 2 (EC 2.7.10.1) (Epithelial cell kinase) (Tyrosine protein kinase receptor ECK)
  • Length: 976  
  • Mass: 108266
  • Tissue specificity: Expressed in brain and glioma tissue and glioma cell lines (at protein level). Expressed most highly in tissues that contain a high proportion of epithelial cells, e.g. skin, intestine, lung, and ovary. {ECO
• Sequence:

  MELQAARACFALLWGCALAAAAAAQGKEVVLLDFAAAGGELGWLTHPYGKGWDLMQNIMNDMPIYMYSVCNVMSG
  DQDNWLRTNWVYRGEAERIFIELKFTVRDCNSFPGGASSCKETFNLYYAESDLDYGTNFQKRLFTKIDTIAPDEI
  TVSSDFEARHVKLNVEERSVGPLTRKGFYLAFQDIGACVALLSVRVYYKKCPELLQGLAHFPETIAGSDAPSLAT
  VAGTCVDHAVVPPGGEEPRMHCAVDGEWLVPIGQCLCQAGYEKVEDACQACSPGFFKFEASESPCLECPEHTLPS
  PEGATSCECEEGFFRAPQDPASMPCTRPPSAPHYLTAVGMGAKVELRWTPPQDSGGREDIVYSVTCEQCWPESGE
  CGPCEASVRYSEPPHGLTRTSVTVSDLEPHMNYTFTVEARNGVSGLVTSRSFRTASVSINQTEPPKVRLEGRSTT
  SLSVSWSIPPPQQSRVWKYEVTYRKKGDSNSYNVRRTEGFSVTLDDLAPDTTYLVQVQALTQEGQGAGSKVHEFQ
  TLSPEGSGNLAVIGGVAVGVVLLLVLAGVGFFIHRRRKNQRARQSPEDVYFSKSEQLKPLKTYVDPHTYEDPNQA
  VLKFTTEIHPSCVTRQKVIGAGEFGEVYKGMLKTSSGKKEVPVAIKTLKAGYTEKQRVDFLGEAGIMGQFSHHNI
  IRLEGVISKYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGMLRGIAAGMKYLANMNYVHRDLAARNILVNSN
  LVCKVSDFGLSRVLEDDPEATYTTSGGKIPIRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHE
  VMKAINDGFRLPTPMDCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRLPSTSG
  SEGVPFRTVSEWLESIKMQQYTEHFMAAGYTAIEKVVQMTNDDIKRIGVRLPGHQKRIAYSLLGLKDQVNTVGIP
  I

• Structural information:
  • Protein Domains: (28..20-)
    (/note="Eph-LBD)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00883-)
    (328..43-)
    1 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316-)
    (438..52-)
    2 (/note="Fibronectin-type-III)
    (/evidence="ECO:000-)
  • Interpro: IPR027936  IPR034263  IPR001090  IPR003961  IPR036116   IPR008979  IPR009030  IPR013783  IPR011009  IPR000719  IPR017441  IPR001660  IPR013761  IPR001245  IPR011641  IPR008266  IPR020635  IPR016257  IPR001426  
  • Prosite: PS51550 PS50853 PS00107 PS50011 PS00109 PS00790 PS00791 PS50105
  • CDD: cd10480 cd00063
  • PDB: 1MQB 2E8N 2K9Y 2KSO 2X10 2X11 3C8X 3CZU 3FL7 3HEI 3HPN 3KKA 3MBW 3MX0 3SKJ 4P2K 4PDO 4TRL 5EK7 5I9U 5I9V 5I9W 5I9X 5I9Y 5I9Z 5IA0 5IA1 5IA2 5IA3 5IA4 5IA5 5NJZ 5NK0 5NK1 5NK2 5NK3 5NK4 5NK5 5NK6 5NK7 5NK8 5NK9 5NKA 5NKB 5NKC 5NKD 5NKE 5NKF 5NKG 5NKH 5NKI 5NZ9 6B9L 6F7M 6F7N 6FNF 6FNG 6FNH 6HES 6HET 6HEU 6HEV 6HEW 6HE
  • PDBsum: 1MQB 2E8N 2K9Y 2KSO 2X10 2X11 3C8X 3CZU 3FL7 3HEI 3HPN 3KKA 3MBW 3MX0 3SKJ 4P2K 4PDO 4TRL 5EK7 5I9U 5I9V 5I9W 5I9X 5I9Y 5I9Z 5IA0 5IA1 5IA2 5IA3 5IA4 5IA5 5NJZ 5NK0 5NK1 5NK2 5NK3 5NK4 5NK5 5NK6 5NK7 5NK8 5NK9 5NKA 5NKB 5NKC 5NKD 5NKE 5NKF 5NKG 5NKH 5NKI 5NZ9 6B9L 6F7M 6F7N 6FNF 6FNG 6FNH 6HES 6HET 6HEU 6HEV 6HEW 6HE
  • DIP: 96
  • STRING: ENSP00000351209
• Other Databases: GeneCards:  EPHA2  Malacards:  EPHA2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070160	tight junction	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:1903348	positive regulation of bicellular tight junction assembly	IMP	biological process
GO:0072659	protein localization to plasma membrane	IMP	biological process
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IBA	molecular function
GO:0033674	positive regulation of kinase activity	IBA	biological process
GO:0043005	neuron projection	IBA	cellular component
GO:0043235	receptor complex	IBA	cellular component
GO:0005005	transmembrane-ephrin receptor activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IBA	biological process
GO:0007275	multicellular organism development	IBA	biological process
GO:0007411	axon guidance	IBA	biological process
GO:0048013	ephrin receptor signaling pathway	IDA	biological process
GO:0048013	ephrin receptor signaling pathway	IDA	biological process
GO:0043491	protein kinase B signaling	IDA	biological process
GO:0031256	leading edge membrane	IDA	cellular component
GO:0031256	leading edge membrane	IDA	cellular component
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IDA	molecular function
GO:0051898	negative regulation of protein kinase B signaling	IDA	biological process
GO:0033628	regulation of cell adhesion mediated by integrin	IDA	biological process
GO:0005925	focal adhesion	IDA	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0030027	lamellipodium	IDA	cellular component
GO:0070372	regulation of ERK1 and ERK2 cascade	IMP	biological process
GO:0070309	lens fiber cell morphogenesis	ISS	biological process
GO:0033598	mammary gland epithelial cell proliferation	ISS	biological process
GO:0090630	activation of GTPase activity	IMP	biological process
GO:0016477	cell migration	IMP	biological process
GO:0010591	regulation of lamellipodium assembly	IMP	biological process
GO:0001649	osteoblast differentiation	ISS	biological process
GO:0048870	cell motility	IMP	biological process
GO:0046058	cAMP metabolic process	IMP	biological process
GO:1903078	positive regulation of protein localization to plasma membrane	IMP	biological process
GO:0070848	response to growth factor	IMP	biological process
GO:0060444	branching involved in mammary gland duct morphogenesis	ISS	biological process
GO:0060326	cell chemotaxis	IMP	biological process
GO:0060326	cell chemotaxis	IMP	biological process
GO:0046849	bone remodeling	ISS	biological process
GO:0045765	regulation of angiogenesis	ISS	biological process
GO:0043535	regulation of blood vessel endothelial cell migration	ISS	biological process
GO:0030316	osteoclast differentiation	ISS	biological process
GO:0030216	keratinocyte differentiation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0005003	ephrin receptor activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0006468	protein phosphorylation	IEA	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0001618	virus receptor activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0001525	angiogenesis	IEA	biological process
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016032	viral process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0016310	phosphorylation	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0006915	apoptotic process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007275	multicellular organism development	TAS	biological process
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0048013	ephrin receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1904238	pericyte cell differentiation	IEA	biological process
GO:1901491	negative regulation of lymphangiogenesis	IEA	biological process
GO:0070309	lens fiber cell morphogenesis	IEA	biological process
GO:0050830	defense response to Gram-positive bacterium	IEA	biological process
GO:0048570	notochord morphogenesis	IEA	biological process
GO:0048514	blood vessel morphogenesis	IEA	biological process
GO:0048013	ephrin receptor signaling pathway	IEA	biological process
GO:0036342	post-anal tail morphogenesis	IEA	biological process
GO:0033598	mammary gland epithelial cell proliferation	IEA	biological process
GO:0021915	neural tube development	IEA	biological process
GO:0016525	negative regulation of angiogenesis	IEA	biological process
GO:0002043	blood vessel endothelial cell proliferation involved in sprouting angiogenesis	IEA	biological process
GO:0001818	negative regulation of cytokine production	IEA	biological process
GO:0001649	osteoblast differentiation	IEA	biological process
GO:0001570	vasculogenesis	IEA	biological process
GO:0001501	skeletal system development	IEA	biological process
GO:0060444	branching involved in mammary gland duct morphogenesis	IEA	biological process
GO:0060035	notochord cell development	IEA	biological process
GO:0048320	axial mesoderm formation	IEA	biological process
GO:0046849	bone remodeling	IEA	biological process
GO:0045765	regulation of angiogenesis	IEA	biological process
GO:0043535	regulation of blood vessel endothelial cell migration	IEA	biological process
GO:0032682	negative regulation of chemokine production	IEA	biological process
GO:0030316	osteoclast differentiation	IEA	biological process
GO:0030182	neuron differentiation	IEA	biological process
GO:0014028	notochord formation	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0001568	blood vessel development	IEA	biological process
GO:0045296	cadherin binding	HDA	molecular function
GO:0032587	ruffle membrane	IEA	cellular component
GO:0031258	lamellipodium membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005925	focal adhesion	IEA	cellular component
GO:0046718	viral entry into host cell	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0008630	intrinsic apoptotic signaling pathway in response to DNA damage	IDA	biological process
GO:0009986	cell surface	HDA	cellular component
GO:0005925	focal adhesion	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa04010	MAPK signaling pathway
hsa04014	Ras signaling pathway
hsa04015	Rap1 signaling pathway
hsa04360	Axon guidance

Diseases

Associated diseases	References
Cataract	KEGG:H01202
Cataract	KEGG:H01202
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq