About Us

Search Result


Gene id 196883
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol ADCY4   Gene   UCSC   Ensembl
Aliases AC4
Gene name adenylate cyclase 4
Alternate names adenylate cyclase type 4, ATP pyrophosphate-lyase 4, adenylate cyclase type IV, adenylyl cyclase 4,
Gene location 14q12 (24335070: 24318358)     Exons: 26     NC_000014.9
Gene summary(Entrez) This gene encodes a member of the family of adenylate cyclases, which are membrane-associated enzymes that catalyze the formation of the secondary messenger cyclic adenosine monophosphate (cAMP). Mouse studies show that adenylate cyclase 4, along with ade
OMIM 616157

Protein Summary

Protein general information Q8NFM4  

Name: Adenylate cyclase type 4 (EC 4.6.1.1) (ATP pyrophosphate lyase 4) (Adenylate cyclase type IV) (Adenylyl cyclase 4)

Length: 1077  Mass: 119794

Tissue specificity: Detected in the zona glomerulosa and the zona fasciculata in the adrenal gland (at protein level). {ECO

Sequence MARLFSPRPPPSEDLFYETYYSLSQQYPLLLLLLGIVLCALAALLAVAWASGRELTSDPSFLTTVLCALGGFSLL
LGLASREQRLQRWTRPLSGLVWVALLALGHAFLFTGGVVSAWDQVSYFLFVIFTAYAMLPLGMRDAAVAGLASSL
SHLLVLGLYLGPQPDSRPALLPQLAANAVLFLCGNVAGVYHKALMERALRATFREALSSLHSRRRLDTEKKHQEH
LLLSILPAYLAREMKAEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATGVDINMRVGVHSGSVL
CGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAGAYAVEDAGMEHRDPYLRELGEPTYLVIDPR
AEEEDEKGTAGGLLSSLEGLKMRPSLLMTRYLESWGAAKPFAHLSHGDSPVSTSTPLPEKTLASFSTQWSLDRSR
TPRGLDDELDTGDAKFFQVIEQLNSQKQWKQSKDFNPLTLYFREKEMEKEYRLSAIPAFKYYEACTFLVFLSNFI
IQMLVTNRPPALAITYSITFLLFLLILFVCFSEDLMRCVLKGPKMLHWLPALSGLVATRPGLRIALGTATILLVF
AMAITSLFFFPTSSDCPFQAPNVSSMISNLSWELPGSLPLISVPYSMHCCTLGFLSCSLFLHMSFELKLLLLLLW
LAASCSLFLHSHAWLSECLIVRLYLGPLDSRPGVLKEPKLMGAISFFIFFFTLLVLARQNEYYCRLDFLWKKKLR
QEREETETMENLTRLLLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLR
LLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDAQQDAERSCSHLGTMVEFAVALGSKLDVINK
HSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMESTGVLGKIQVTEETAWALQSLGYTCYSRGVIK
VKGKGQLCTYFLNTDLTRTGPPSATLG
Structural information
Interpro:  IPR001054  IPR018297  IPR032628  IPR030672  IPR009398  
IPR029787  
Prosite:   PS00452 PS50125
STRING:   ENSP00000312126
Other Databases GeneCards:  ADCY4  Malacards:  ADCY4

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0007189 adenylate cyclase-activat
ing G protein-coupled rec
eptor signaling pathway
IBA biological process
GO:0004016 adenylate cyclase activit
y
IBA molecular function
GO:0005887 integral component of pla
sma membrane
IBA cellular component
GO:0004016 adenylate cyclase activit
y
IEA molecular function
GO:0005886 plasma membrane
IEA cellular component
GO:0006171 cAMP biosynthetic process
IEA biological process
GO:0009190 cyclic nucleotide biosynt
hetic process
IEA biological process
GO:0016849 phosphorus-oxygen lyase a
ctivity
IEA molecular function
GO:0035556 intracellular signal tran
sduction
IEA biological process
GO:0046872 metal ion binding
IEA molecular function
GO:0016829 lyase activity
IEA molecular function
GO:0016021 integral component of mem
brane
IEA cellular component
GO:0006171 cAMP biosynthetic process
IEA biological process
GO:0000166 nucleotide binding
IEA molecular function
GO:0016020 membrane
IEA cellular component
GO:0005737 cytoplasm
IEA cellular component
GO:0005524 ATP binding
IEA molecular function
GO:0005886 plasma membrane
IEA cellular component
GO:0004016 adenylate cyclase activit
y
IEA molecular function
GO:0003091 renal water homeostasis
TAS biological process
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0007186 G protein-coupled recepto
r signaling pathway
TAS biological process
GO:0007190 activation of adenylate c
yclase activity
TAS biological process
GO:0007193 adenylate cyclase-inhibit
ing G protein-coupled rec
eptor signaling pathway
TAS biological process
GO:0071377 cellular response to gluc
agon stimulus
TAS biological process
GO:0007189 adenylate cyclase-activat
ing G protein-coupled rec
eptor signaling pathway
TAS biological process
GO:0034199 activation of protein kin
ase A activity
TAS biological process
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0030425 dendrite
IEA cellular component
GO:0007188 adenylate cyclase-modulat
ing G protein-coupled rec
eptor signaling pathway
IEA biological process
GO:0004016 adenylate cyclase activit
y
ISS molecular function
GO:0006171 cAMP biosynthetic process
ISS biological process
GO:0016020 membrane
ISS cellular component
GO:0005886 plasma membrane
IEA cellular component
GO:0005737 cytoplasm
IEA cellular component
GO:0005080 protein kinase C binding
IDA molecular function
GO:0005737 cytoplasm
IDA cellular component
GO:0005515 protein binding
IPI molecular function
GO:0007188 adenylate cyclase-modulat
ing G protein-coupled rec
eptor signaling pathway
ISS biological process
GO:0005515 protein binding
IPI molecular function

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa01100Metabolic pathways
hsa05200Pathways in cancer
hsa04714Thermogenesis
hsa04015Rap1 signaling pathway
hsa04024cAMP signaling pathway
hsa05166Human T-cell leukemia virus 1 infection
hsa05163Human cytomegalovirus infection
hsa04020Calcium signaling pathway
hsa04062Chemokine signaling pathway
hsa04022cGMP-PKG signaling pathway
hsa04723Retrograde endocannabinoid signaling
hsa00230Purine metabolism
hsa04261Adrenergic signaling in cardiomyocytes
hsa04934Cushing syndrome
hsa04072Phospholipase D signaling pathway
hsa04921Oxytocin signaling pathway
hsa04371Apelin signaling pathway
hsa04724Glutamatergic synapse
hsa04270Vascular smooth muscle contraction
hsa04114Oocyte meiosis
hsa04611Platelet activation
hsa04926Relaxin signaling pathway
hsa04725Cholinergic synapse
hsa04935Growth hormone synthesis, secretion and action
hsa04915Estrogen signaling pathway
hsa04916Melanogenesis
hsa05032Morphine addiction
hsa04727GABAergic synapse
hsa04713Circadian entrainment
hsa04925Aldosterone synthesis and secretion
hsa04928Parathyroid hormone synthesis, secretion and action
hsa04972Pancreatic secretion
hsa05414Dilated cardiomyopathy
hsa04750Inflammatory mediator regulation of TRP channels
hsa04970Salivary secretion
hsa04914Progesterone-mediated oocyte maturation
hsa04912GnRH signaling pathway
hsa04911Insulin secretion
hsa04540Gap junction
hsa04211Longevity regulating pathway
hsa01522Endocrine resistance
hsa04971Gastric acid secretion
hsa04918Thyroid hormone synthesis
hsa04742Taste transduction
hsa04976Bile secretion
hsa04927Cortisol synthesis and secretion
hsa04213Longevity regulating pathway - multiple species
hsa04923Regulation of lipolysis in adipocytes
hsa04913Ovarian steroidogenesis
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm

18
Male infertility GSE26881
Show abstract