• Gene id: 196527

Gene Summary

• Gene Symbol: ANO6   Gene   UCSC   Ensembl
• Aliases: BDPLT7, SCTS, TMEM16F
• Gene name: anoctamin 6
• Alternate names: anoctamin-6, SCAN channel, small-conductance calcium-activated nonselective cation channel, transmembrane protein 16F,
• Gene location: 12q12 (27154478: 27187952)     Exons: 16     NC_000010.11
• Gene summary(Entrez): This gene encodes a multi-pass transmembrane protein that belongs to the anoctamin family. This protein is an essential component for the calcium-dependent exposure of phosphatidylserine on the cell surface. The scrambling of phospholipid occurs in variou
• OMIM: 608663

Protein Summary

• Protein general information: Q4KMQ2  
  • Name: Anoctamin 6 (Small conductance calcium activated nonselective cation channel) (SCAN channel) (Transmembrane protein 16F)
  • Length: 910  
  • Mass: 106165
  • Tissue specificity: Expressed in embryonic stem cell, fetal liver, retina, chronic myologenous leukemia and intestinal cancer. {ECO
• Sequence:

  MKKMSRNVLLQMEEEEDDDDGDIVLENLGQTIVPDLGSLESQHDFRTPEFEEFNGKPDSLFFNDGQRRIDFVLVY
  EDESRKETNKKGTNEKQRRKRQAYESNLICHGLQLEATRSVLDDKLVFVKVHAPWEVLCTYAEIMHIKLPLKPND
  LKNRSSAFGTLNWFTKVLSVDESIIKPEQEFFTAPFEKNRMNDFYIVDRDAFFNPATRSRIVYFILSRVKYQVIN
  NVSKFGINRLVNSGIYKAAFPLHDCKFRRQSEDPSCPNERYLLYREWAHPRSIYKKQPLDLIRKYYGEKIGIYFA
  WLGYYTQMLLLAAVVGVACFLYGYLNQDNCTWSKEVCHPDIGGKIIMCPQCDRLCPFWKLNITCESSKKLCIFDS
  FGTLVFAVFMGVWVTLFLEFWKRRQAELEYEWDTVELQQEEQARPEYEARCTHVVINEITQEEERIPFTAWGKCI
  RITLCASAVFFWILLIIASVIGIIVYRLSVFIVFSAKLPKNINGTDPIQKYLTPQTATSITASIISFIIIMILNT
  IYEKVAIMITNFELPRTQTDYENSLTMKMFLFQFVNYYSSCFYIAFFKGKFVGYPGDPVYWLGKYRNEECDPGGC
  LLELTTQLTIIMGGKAIWNNIQEVLLPWIMNLIGRFHRVSGSEKITPRWEQDYHLQPMGKLGLFYEYLEMIIQFG
  FVTLFVASFPLAPLLALVNNILEIRVDAWKLTTQFRRLVPEKAQDIGAWQPIMQGIAILAVVTNAMIIAFTSDMI
  PRLVYYWSFSVPPYGDHTSYTMEGYINNTLSIFKVADFKNKSKGNPYSDLGNHTTCRYRDFRYPPGHPQEYKHNI
  YYWHVIAAKLAFIIVMEHVIYSVKFFISYAIPDVSKRTKSKIQREKYLTQKLLHENHLKDMTKNMGVIAERMIEA
  VDNNLRPKSE

• Structural information:
  • Interpro: IPR032394  IPR007632  IPR031295  
  • STRING: ENSP00000409126
• Other Databases: GeneCards:  ANO6  Malacards:  ANO6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1902476	chloride transmembrane transport	IBA	biological process
GO:0005254	chloride channel activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0055085	transmembrane transport	IBA	biological process
GO:0061589	calcium activated phosphatidylserine scrambling	IBA	biological process
GO:0061590	calcium activated phosphatidylcholine scrambling	IBA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005229	intracellular calcium activated chloride channel activity	IDA	NOT|molecular function
GO:0097045	phosphatidylserine exposure on blood platelet	IMP	biological process
GO:0017121	plasma membrane phospholipid scrambling	ISS	biological process
GO:0007596	blood coagulation	ISS	biological process
GO:0005244	voltage-gated ion channel activity	ISS	molecular function
GO:0005227	calcium activated cation channel activity	ISS	molecular function
GO:0002543	activation of blood coagulation via clotting cascade	IMP	biological process
GO:0007596	blood coagulation	IEA	biological process
GO:0030501	positive regulation of bone mineralization	IEA	biological process
GO:0034767	positive regulation of ion transmembrane transport	IEA	biological process
GO:0061588	calcium activated phospholipid scrambling	IEA	biological process
GO:1902476	chloride transmembrane transport	IEA	biological process
GO:0002407	dendritic cell chemotaxis	IEA	biological process
GO:0046983	protein dimerization activity	IEA	molecular function
GO:0034707	chloride channel complex	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005244	voltage-gated ion channel activity	IEA	molecular function
GO:0006821	chloride transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0034765	regulation of ion transmembrane transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005254	chloride channel activity	IEA	molecular function
GO:0006869	lipid transport	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0034220	ion transmembrane transport	TAS	biological process
GO:0035579	specific granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0070821	tertiary granule membrane	TAS	cellular component
GO:1902476	chloride transmembrane transport	IEA	biological process
GO:0061591	calcium activated galactosylceramide scrambling	IEA	biological process
GO:0061588	calcium activated phospholipid scrambling	IEA	biological process
GO:0045794	negative regulation of cell volume	IEA	biological process
GO:0042803	protein homodimerization activity	IEA	molecular function
GO:0035630	bone mineralization involved in bone maturation	IEA	biological process
GO:0035590	purinergic nucleotide receptor signaling pathway	IEA	biological process
GO:0034767	positive regulation of ion transmembrane transport	IEA	biological process
GO:0030501	positive regulation of bone mineralization	IEA	biological process
GO:0017128	phospholipid scramblase activity	IEA	molecular function
GO:0017121	plasma membrane phospholipid scrambling	IEA	biological process
GO:0007596	blood coagulation	IEA	biological process
GO:0006821	chloride transport	IEA	biological process
GO:0005244	voltage-gated ion channel activity	IEA	molecular function
GO:0005227	calcium activated cation channel activity	IEA	molecular function
GO:1903766	positive regulation of potassium ion export across plasma membrane	IEA	biological process
GO:0090026	positive regulation of monocyte chemotaxis	IEA	biological process
GO:0070588	calcium ion transmembrane transport	IEA	biological process
GO:0061590	calcium activated phosphatidylcholine scrambling	IEA	biological process
GO:0061589	calcium activated phosphatidylserine scrambling	IEA	biological process
GO:0060100	positive regulation of phagocytosis, engulfment	IEA	biological process
GO:0045332	phospholipid translocation	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0032060	bleb assembly	IEA	biological process
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0002407	dendritic cell chemotaxis	IEA	biological process
GO:1903766	positive regulation of potassium ion export across plasma membrane	ISS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0034707	chloride channel complex	IDA	cellular component
GO:0005227	calcium activated cation channel activity	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0006812	cation transport	IDA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0045794	negative regulation of cell volume	IMP	biological process
GO:0005227	calcium activated cation channel activity	IMP	molecular function
GO:0030501	positive regulation of bone mineralization	IMP	biological process
GO:0035725	sodium ion transmembrane transport	IGI	biological process
GO:0005247	voltage-gated chloride channel activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0009986	cell surface	HDA	cellular component
GO:0032060	bleb assembly	IMP	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0006821	chloride transport	IMP	biological process
GO:0006821	chloride transport	IMP	biological process
GO:0046931	pore complex assembly	IMP	biological process
GO:0035590	purinergic nucleotide receptor signaling pathway	IMP	biological process
GO:0017121	plasma membrane phospholipid scrambling	IMP	biological process
GO:0034767	positive regulation of ion transmembrane transport	IMP	biological process
GO:1902476	chloride transmembrane transport	IGI	biological process
GO:2000353	positive regulation of endothelial cell apoptotic process	IMP	biological process
GO:0005229	intracellular calcium activated chloride channel activity	IMP	molecular function
GO:0016020	membrane	HDA	cellular component
GO:0090026	positive regulation of monocyte chemotaxis	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0070588	calcium ion transmembrane transport	IGI	biological process
GO:0043065	positive regulation of apoptotic process	ISS	biological process
GO:0060100	positive regulation of phagocytosis, engulfment	ISS	biological process

Diseases

Associated diseases	References
Scott syndrome	KEGG:H01162
Scott syndrome	KEGG:H01162
Inflammatory bowel disease	PMID:23308121
Ankylosing spondylitis	PMID:23308121
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray