• Gene id: 196513

Gene Summary

• Gene Symbol: DCP1B   Gene   UCSC   Ensembl
• Aliases: DCP1
• Gene name: decapping mRNA 1B
• Alternate names: mRNA-decapping enzyme 1B, DCP1 decapping enzyme homolog B, decapping enzyme hDcp1b,
• Gene location: 12p13.33 (325570: 330227)     Exons: 1     NC_000020.11
• Gene summary(Entrez): This gene encodes a member of a family of proteins that function in removing the 5' cap from mRNAs, which is a step in regulated mRNA decay. This protein localizes to cytoplasmic foci which are the site of mRNA breakdown and turnover. Alternative splicing
• OMIM: 609843

Protein Summary

• Protein general information: Q8IZD4  
  • Name: mRNA decapping enzyme 1B (EC 3. . . )
  • Length: 617  
  • Mass: 67723
• Sequence:

  MAAVAAGGLVGKGRDISLAALQRHDPYINRIVDVASQVALYTFGHRANEWEKTDVEGTLFVYTRSASPKHGFTIM
  NRLSMENRTEPITKDLDFQLQDPFLLYRNARLSIYGIWFYDKEECQRIAELMKNLTQYEQLKAHQGTGAGISPVI
  LNSGEGKEVDILRMLIKAKDEYTKCKTCSEPKKITSSSAIYDNPNLIKPIPVKPSENQQQRIPQPNQTLDPEPQH
  LSLTALFGKQDKATCQETVEPPQTLHQQQQQQQQQQEKLPIRQGVVRSLSYEEPRRHSPPIEKQLCPAIQKLMVR
  SADLHPLSELPENRPCENGSTHSAGEFFTGPVQPGSPHNIGTSRGVQNASRTQNLFEKLQSTPGAANKCDPSTPA
  PASSAALNRSRAPTSVTPVAPGKGLAQPPQAYFNGSLPPQTVGHQAHGREQSTLPRQTLPISGSQTGSSGVISPQ
  ELLKKLQIVQQEQQLHASNRPALAAKFPVLAQSSGTGKPLESWINKTPNTEQQTPLFQVISPQRIPATAAPSLLM
  SPMVFAQPTSVPPKERESGLLPVGGQEPPAAATSLLLPIQSPEPSVITSSPLTKLQLQEALLYLIQNDDNFLNII
  YEAYLFSMTQAAMKKTM

• Structural information:
  • Interpro: IPR010334  IPR031953  IPR011993  
  • DIP: 31289
  • STRING: ENSP00000280665
• Other Databases: GeneCards:  DCP1B  Malacards:  DCP1B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000290	deadenylation-dependent decapping of nuclear-transcribed mRNA	IBA	biological process
GO:0000932	P-body	IBA	cellular component
GO:0003729	mRNA binding	IBA	molecular function
GO:0030234	enzyme regulator activity	IBA	molecular function
GO:0031087	deadenylation-independent decapping of nuclear-transcribed mRNA	IBA	biological process
GO:0000290	deadenylation-dependent decapping of nuclear-transcribed mRNA	IEA	biological process
GO:0008047	enzyme activator activity	IEA	molecular function
GO:0043085	positive regulation of catalytic activity	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0043928	exonucleolytic catabolism of deadenylated mRNA	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03018	RNA degradation

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq