• Gene id: 1965

Gene Summary

• Gene Symbol: EIF2S1   Gene   UCSC   Ensembl
• Aliases: EIF-2, EIF-2A, EIF-2alpha, EIF2, EIF2A
• Gene name: eukaryotic translation initiation factor 2 subunit alpha
• Alternate names: eukaryotic translation initiation factor 2 subunit 1, eIF-2-alpha, eukaryotic translation initiation factor 2, subunit 1 alpha, 35kDa,
• Gene location: 14q23.3 (67360327: 67386515)     Exons: 8     NC_000014.9
• Gene summary(Entrez): The translation initiation factor EIF2 catalyzes the first regulated step of protein synthesis initiation, promoting the binding of the initiator tRNA to 40S ribosomal subunits. Binding occurs as a ternary complex of methionyl-tRNA, EIF2, and GTP. EIF2 is
• OMIM: 603907

Protein Summary

• Protein general information: P05198  
  • Name: Eukaryotic translation initiation factor 2 subunit 1 (Eukaryotic translation initiation factor 2 subunit alpha) (eIF 2 alpha) (eIF 2A) (eIF 2alpha)
  • Length: 315  
  • Mass: 36112
• Sequence:

  MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSINKLIRIGRNECVVVIR
  VDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLEYTKDEQLESLFQRTAWVFDDKYKRPGYGAY
  DAFKHAVSDPSILDSLDLNEDEREVLINNINRRLTPQAVKIRADIEVACYGYEGIDAVKEALRAGLNCSTENMPI
  KINLIAPPRYVMTTTTLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQMERLERENAEV
  DGDDDAEEMEAKAED

• Structural information:
  • Protein Domains: (17..8-)
    (/note="S1-motif)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00180"-)
  • Interpro: IPR012340  IPR022967  IPR003029  IPR024055  IPR024054   IPR011488  
  • Prosite: PS50126
  • PDB: 1KL9 1Q8K 6K71 6K72 6O81 6O85 6O9Z
  • PDBsum: 1KL9 1Q8K 6K71 6K72 6O81 6O85 6O9Z
  • DIP: 39418
  • STRING: ENSP00000256383
• Other Databases: GeneCards:  EIF2S1  Malacards:  EIF2S1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0034063	stress granule assembly	ISS	biological process
GO:0034599	cellular response to oxidative stress	ISS	biological process
GO:0036499	PERK-mediated unfolded protein response	NAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:1901216	positive regulation of neuron death	IMP	biological process
GO:0034976	response to endoplasmic reticulum stress	IMP	biological process
GO:0003723	RNA binding	IBA	molecular function
GO:0005850	eukaryotic translation initiation factor 2 complex	IBA	cellular component
GO:0005851	eukaryotic translation initiation factor 2B complex	IBA	cellular component
GO:0043614	multi-eIF complex	IBA	cellular component
GO:0003743	translation initiation factor activity	IBA	molecular function
GO:0033290	eukaryotic 48S preinitiation complex	IBA	cellular component
GO:0043022	ribosome binding	IBA	molecular function
GO:0043022	ribosome binding	IDA	molecular function
GO:0005850	eukaryotic translation initiation factor 2 complex	IDA	cellular component
GO:0034198	cellular response to amino acid starvation	ISS	biological process
GO:0032057	negative regulation of translational initiation in response to stress	ISS	biological process
GO:0010494	cytoplasmic stress granule	ISS	cellular component
GO:0034976	response to endoplasmic reticulum stress	ISS	biological process
GO:0034644	cellular response to UV	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0003743	translation initiation factor activity	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0006412	translation	IEA	biological process
GO:0006417	regulation of translation	IEA	biological process
GO:0003743	translation initiation factor activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006413	translational initiation	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0003743	translation initiation factor activity	TAS	molecular function
GO:0005844	polysome	TAS	cellular component
GO:0006413	translational initiation	TAS	biological process
GO:0055085	transmembrane transport	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1990737	response to manganese-induced endoplasmic reticulum stress	IEA	biological process
GO:1901216	positive regulation of neuron death	IEA	biological process
GO:0005850	eukaryotic translation initiation factor 2 complex	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0034976	response to endoplasmic reticulum stress	IEA	biological process
GO:0034644	cellular response to UV	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:2000676	positive regulation of type B pancreatic cell apoptotic process	IEA	biological process
GO:1905098	negative regulation of guanyl-nucleotide exchange factor activity	IEA	biological process
GO:0097451	glial limiting end-foot	IEA	cellular component
GO:0044207	translation initiation ternary complex	IEA	cellular component
GO:0034605	cellular response to heat	IEA	biological process
GO:0007568	aging	IEA	biological process
GO:0046777	protein autophosphorylation	IEA	biological process
GO:0043558	regulation of translational initiation in response to stress	IEA	biological process
GO:0034599	cellular response to oxidative stress	IEA	biological process
GO:0034198	cellular response to amino acid starvation	IEA	biological process
GO:0034063	stress granule assembly	IEA	biological process
GO:0032057	negative regulation of translational initiation in response to stress	IEA	biological process
GO:0010494	cytoplasmic stress granule	IEA	cellular component
GO:0006412	translation	IEA	biological process
GO:0010494	cytoplasmic stress granule	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0003743	translation initiation factor activity	IDA	molecular function
GO:0005851	eukaryotic translation initiation factor 2B complex	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05168	Herpes simplex virus 1 infection
hsa05010	Alzheimer disease
hsa05012	Parkinson disease
hsa03013	RNA transport
hsa04141	Protein processing in endoplasmic reticulum
hsa04140	Autophagy - animal
hsa04932	Non-alcoholic fatty liver disease
hsa05164	Influenza A
hsa05160	Hepatitis C
hsa04210	Apoptosis
hsa05162	Measles

Diseases

Associated diseases	References
Alzheimer's disease	PMID:16954686
Alzheimer's disease	PMID:16691116
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)