• Gene id: 1964

Gene Summary

• Gene Symbol: EIF1AX   Gene   UCSC   Ensembl
• Aliases: EIF1A, EIF1AP1, EIF4C, eIF-1A, eIF-4C
• Gene name: eukaryotic translation initiation factor 1A X-linked
• Alternate names: eukaryotic translation initiation factor 1A, X-chromosomal, Putative eukaryotic translation initiation factor 1A, eIF-1A X isoform, eukaryotic translation initiation factor 1A, X chromosome, eukaryotic translation initiation factor 4C,
• Gene location: Xp22.12 (20141837: 20124524)     Exons: 7     NC_000023.11
• Gene summary(Entrez): This gene encodes an essential eukaryotic translation initiation factor. The protein is required for the binding of the 43S complex (a 40S subunit, eIF2/GTP/Met-tRNAi and eIF3) to the 5' end of capped RNA. [provided by RefSeq, Jul 2008]
• OMIM: 300186

Protein Summary

• Protein general information: P47813  
  • Name: Eukaryotic translation initiation factor 1A, X chromosomal (eIF 1A X isoform) (Eukaryotic translation initiation factor 4C) (eIF 4C)
  • Length: 144  
  • Mass: 16460
• Sequence:

  MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSD
  IILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI

• Structural information:
  • Protein Domains: (22..9-)
    (/note="S1-like"-)
  • Interpro: IPR012340  IPR006196  IPR001253  IPR018104  
  • Prosite: PS01262 PS50832
  • CDD: cd05793
  • PDB: 1D7Q 3ZJY 4KZY 4KZZ
  • PDBsum: 1D7Q 3ZJY 4KZY 4KZZ
  • DIP: 40995
  • STRING: ENSP00000368927
• Other Databases: GeneCards:  EIF1AX  Malacards:  EIF1AX

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003743	translation initiation factor activity	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0006413	translational initiation	IEA	biological process
GO:0006412	translation	IEA	biological process
GO:0003743	translation initiation factor activity	IEA	molecular function
GO:0006413	translational initiation	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0008135	translation factor activity, RNA binding	TAS	molecular function
GO:0006413	translational initiation	TAS	biological process
GO:0006413	translational initiation	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03013	RNA transport

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray