• Gene id: 196383

Gene Summary

• Gene Symbol: RILPL2   Gene   UCSC   Ensembl
• Aliases: RLP2
• Gene name: Rab interacting lysosomal protein like 2
• Alternate names: RILP-like protein 2, p40phox-binding protein, rab-interacting lysosomal protein-like 2,
• Gene location: 12q24.31 (123436732: 123409889)     Exons: 5     NC_000012.12
• Gene summary(Entrez): This gene encodes a protein that contains a rab-interacting lysosomal protein-like domain. This protein may be involved in regulating lysosome morphology. This protein may also be a target for the Hepatitis C virus and assist in viral replication. Alterna
• OMIM: 611525

Protein Summary

• Protein general information: Q969X0  
  • Name: RILP like protein 2 (Rab interacting lysosomal protein like 2) (p40phox binding protein)
  • Length: 211  
  • Mass: 23986
  • Tissue specificity: Widely expressed. Expressed at higher level in lung. {ECO
• Sequence:

  MEEPPVREEEEEEGEEDEERDEVGPEGALGKSPFQLTAEDVYDISYLLGRELMALGSDPRVTQLQFKVVRVLEML
  EALVNEGSLALEELKMERDHLRKEVEGLRRQSPPASGEVNLGPNKMVVDLTDPNRPRFTLQELRDVLQERNKLKS
  QLLVVQEELQCYKSGLIPPREGPGGRREKDAVVTSAKNAGRNKEEKTIIKKLFFFRSGKQT

• Structural information:
  • Protein Domains: (24..10-)
    (/note="RH1-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01112-)
    (130..20-)
    (/note="RH2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01113"-)
  • Interpro: IPR034743  IPR034744  IPR021563  
  • Prosite: PS51776 PS51777
  • STRING: ENSP00000280571
• Other Databases: GeneCards:  RILPL2  Malacards:  RILPL2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051959	dynein light intermediate chain binding	IBA	molecular function
GO:0031267	small GTPase binding	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:1903445	protein transport from ciliary membrane to plasma membrane	ISS	biological process
GO:0005813	centrosome	ISS	cellular component
GO:0005929	cilium	ISS	cellular component
GO:0003382	epithelial cell morphogenesis	ISS	biological process
GO:0046983	protein dimerization activity	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005813	centrosome	IEA	cellular component
GO:1903445	protein transport from ciliary membrane to plasma membrane	IEA	biological process
GO:0003382	epithelial cell morphogenesis	IEA	biological process
GO:0005929	cilium	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881