• Gene id: 196294

Gene Summary

• Gene Symbol: IMMP1L   Gene   UCSC   Ensembl
• Aliases: IMMP1, IMP1, IMP1-LIKE
• Gene name: inner mitochondrial membrane peptidase subunit 1
• Alternate names: mitochondrial inner membrane protease subunit 1, IMP1 inner mitochondrial membrane peptidase-like,
• Gene location: 11p13 (46086802: 46016989)     Exons: 12     NC_000003.12
• Gene summary(Entrez): The mitochondrial inner membrane peptidase (IMP) complex generates mature, active proteins in the mitochondrial intermembrane space by proteolytically removing the mitochondrial targeting presequence of nuclear-encoded proteins. IMP1 and IMP2 (IMMP2L; MIM
• OMIM: 612323

Protein Summary

• Protein general information: Q96LU5  
  • Name: Mitochondrial inner membrane protease subunit 1 (EC 3.4.21. ) (IMP1 like protein)
  • Length: 166  
  • Mass: 18504
• Sequence:

  MLRGVLGKTFRLVGYTIQYGCIAHCAFEYVGGVVMCSGPSMEPTIQNSDIVFAENLSRHFYGIQRGDIVIAKSPS
  DPKSNICKRVIGLEGDKILTTSPSDFFKSHSYVPMGHVWLEGDNLQNSTDSRCYGPIPYGLIRGRIFFKIWPLSD
  FGFLRASPNGHRFSDD

• Structural information:
  • Interpro: IPR036286  IPR000223  IPR015927  
  • STRING: ENSP00000278200
• Other Databases: GeneCards:  IMMP1L  Malacards:  IMMP1L

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006627	protein processing involved in protein targeting to mitochondrion	IBA	biological process
GO:0042720	mitochondrial inner membrane peptidase complex	IBA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0008150	biological_process	ND	biological process
GO:0005739	mitochondrion	ISS	cellular component
GO:0003674	molecular_function	ND	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03060	Protein export

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray