• Gene id: 196051

Gene Summary

• Gene Symbol: PLPP4   Gene   UCSC   Ensembl
• Aliases: DPPL2, PPAPDC1, PPAPDC1A
• Gene name: phospholipid phosphatase 4
• Alternate names: phospholipid phosphatase 4, diacylglycerol pyrophosphate like 2, diacylglycerol pyrophosphate phosphatase-like 2, phosphatidate phosphatase PPAPDC1A, phosphatidic acid phosphatase type 2 domain containing 1A, phosphatidic acid phosphatase type 2 domain-contain,
• Gene location: 10q26.12 (120456953: 120600122)     Exons: 12     NC_000010.11

Protein Summary

• Protein general information: Q5VZY2  
  • Name: Phospholipid phosphatase 4 (EC 3.1.3.4) (EC 3.1.3.81) (Phosphatidic acid phosphatase type 2 domain containing protein 1A)
  • Length: 271  
  • Mass: 30395
  • Tissue specificity: Expressed mainly to the brain, kidney and testis, and to a lesser extent the bone marrow, thymus, prostate, liver and uterus. {ECO
• Sequence:

  MRELAIEIGVRALLFGVFVFTEFLDPFQRVIQPEEIWLYKNPLVQSDNIPTRLMFAISFLTPLAVICVVKIIRRT
  DKTEIKEAFLAVSLALALNGVCTNTIKLIVGRPRPDFFYRCFPDGVMNSEMHCTGDPDLVSEGRKSFPSIHSSFA
  FSGLGFTTFYLAGKLHCFTESGRGKSWRLCAAILPLYCAMMIALSRMCDYKHHWQDSFVGGVIGLIFAYICYRQH
  YPPLANTACHKPYVSLRVPASLKKEERPTADSAPSLPLEGITEGPV

• Structural information:
  • Interpro: IPR036938  IPR000326  IPR028668  
  • STRING: ENSP00000381302
• Other Databases: GeneCards:  PLPP4  Malacards:  PLPP4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008195	phosphatidate phosphatase activity	IBA	molecular function
GO:0007165	signal transduction	IBA	biological process
GO:0006644	phospholipid metabolic process	IBA	biological process
GO:0046839	phospholipid dephosphorylation	IBA	biological process
GO:0016791	phosphatase activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0000810	diacylglycerol diphosphate phosphatase activity	IDA	molecular function
GO:0090279	regulation of calcium ion import	IMP	biological process
GO:0006644	phospholipid metabolic process	IEA	biological process
GO:0008195	phosphatidate phosphatase activity	IEA	molecular function
GO:0046839	phospholipid dephosphorylation	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0000810	diacylglycerol diphosphate phosphatase activity	IEA	molecular function
GO:0008195	phosphatidate phosphatase activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001835	blastocyst hatching	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0006644	phospholipid metabolic process	IEA	biological process
GO:0046839	phospholipid dephosphorylation	IDA	biological process
GO:0008195	phosphatidate phosphatase activity	IDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa00564	Glycerophospholipid metabolism
hsa00561	Glycerolipid metabolism

Diseases

Associated diseases	References
Breast cancer	PMID:16818692
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq