• Gene id: 1958

Gene Summary

• Gene Symbol: EGR1   Gene   UCSC   Ensembl
• Aliases: AT225, G0S30, KROX-24, NGFI-A, TIS8, ZIF-268, ZNF225
• Gene name: early growth response 1
• Alternate names: early growth response protein 1, EGR-1, nerve growth factor-induced protein A, transcription factor ETR103, transcription factor Zif268, zinc finger protein 225, zinc finger protein Krox-24,
• Gene location: 5q31.2 (138465478: 138469302)     Exons: 2     NC_000005.10
• Gene summary(Entrez): The protein encoded by this gene belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis
• OMIM: 128990

Protein Summary

• Protein general information: P18146  
  • Name: Early growth response protein 1 (EGR 1) (AT225) (Nerve growth factor induced protein A) (NGFI A) (Transcription factor ETR103) (Transcription factor Zif268) (Zinc finger protein 225) (Zinc finger protein Krox 24)
  • Length: 543  
  • Mass: 57507
  • Tissue specificity: Detected in neutrophils (at protein level). {ECO
• Sequence:

  MAAAKAEMQLMSPLQISDPFGSFPHSPTMDNYPKLEEMMLLSNGAPQFLGAAGAPEGSGSNSSSSSSGGGGGGGG
  GSNSSSSSSTFNPQADTGEQPYEHLTAESFPDISLNNEKVLVETSYPSQTTRLPPITYTGRFSLEPAPNSGNTLW
  PEPLFSLVSGLVSMTNPPASSSSAPSPAASSASASQSPPLSCAVPSNDSSPIYSAAPTFPTPNTDIFPEPQSQAF
  PGSAGTALQYPPPAYPAAKGGFQVPMIPDYLFPQQQGDLGLGTPDQKPFQGLESRTQQPSLTPLSTIKAFATQSG
  SQDLKALNTSYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMR
  NFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQKDKKADKSVVASSATSSLSSYPSPVATSY
  PSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSAS
  TGLSDMTATFSPRTIEIC

• Structural information:
  • Interpro: IPR021839  IPR021849  IPR036236  IPR013087  
  • Prosite: PS00028 PS50157
  • PDB: 4R2A 4R2C 4R2D 4X9J 5N14
  • PDBsum: 4R2A 4R2C 4R2D 4X9J 5N14
  • STRING: ENSP00000239938
• Other Databases: GeneCards:  EGR1  Malacards:  EGR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1902895	positive regulation of pri-miRNA transcription by RNA polymerase II	IDA	biological process
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0000790	nuclear chromatin	IDA	is active in
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	molecular function
GO:1902949	positive regulation of tau-protein kinase activity	ISS	biological process
GO:1901216	positive regulation of neuron death	ISS	biological process
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0000976	transcription regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	molecular function
GO:1990841	promoter-specific chromatin binding	IDA	molecular function
GO:0043565	sequence-specific DNA binding	IDA	molecular function
GO:0008270	zinc ion binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0098759	cellular response to interleukin-8	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0044729	hemi-methylated DNA-binding	IDA	molecular function
GO:0010385	double-stranded methylated DNA binding	IDA	molecular function
GO:0045080	positive regulation of chemokine biosynthetic process	ISS	biological process
GO:0002931	response to ischemia	ISS	biological process
GO:0001666	response to hypoxia	ISS	biological process
GO:0045475	locomotor rhythm	ISS	biological process
GO:2000182	regulation of progesterone biosynthetic process	ISS	biological process
GO:0046886	positive regulation of hormone biosynthetic process	ISS	biological process
GO:0044849	estrous cycle	ISS	biological process
GO:0050725	positive regulation of interleukin-1 beta biosynthetic process	ISS	biological process
GO:0060086	circadian temperature homeostasis	ISS	biological process
GO:0032922	circadian regulation of gene expression	ISS	biological process
GO:0048511	rhythmic process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0060337	type I interferon signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000182	regulation of progesterone biosynthetic process	IEA	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0060086	circadian temperature homeostasis	IEA	biological process
GO:0050725	positive regulation of interleukin-1 beta biosynthetic process	IEA	biological process
GO:0046886	positive regulation of hormone biosynthetic process	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0044849	estrous cycle	IEA	biological process
GO:0042981	regulation of apoptotic process	IEA	biological process
GO:0035914	skeletal muscle cell differentiation	IEA	biological process
GO:0032922	circadian regulation of gene expression	IEA	biological process
GO:0030509	BMP signaling pathway	IEA	biological process
GO:0030217	T cell differentiation	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA	molecular function
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:1901216	positive regulation of neuron death	IEA	biological process
GO:0071480	cellular response to gamma radiation	IEA	biological process
GO:0071310	cellular response to organic substance	IEA	biological process
GO:0061418	regulation of transcription from RNA polymerase II promoter in response to hypoxia	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0045475	locomotor rhythm	IEA	biological process
GO:0045080	positive regulation of chemokine biosynthetic process	IEA	biological process
GO:0032868	response to insulin	IEA	biological process
GO:0009749	response to glucose	IEA	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0002931	response to ischemia	IEA	biological process
GO:0001666	response to hypoxia	IEA	biological process
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA	molecular function
GO:1902949	positive regulation of tau-protein kinase activity	IEA	biological process
GO:0035035	histone acetyltransferase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0033233	regulation of protein sumoylation	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0070498	interleukin-1-mediated signaling pathway	IMP	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0000976	transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0043565	sequence-specific DNA binding	IDA	molecular function
GO:0003700	DNA-binding transcription factor activity	IDA	molecular function
GO:0003677	DNA binding	IDA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IGI	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IGI	biological process
GO:0071504	cellular response to heparin	ISS	biological process
GO:0072110	glomerular mesangial cell proliferation	ISS	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0072303	positive regulation of glomerular metanephric mesangial cell proliferation	ISS	biological process
GO:0071506	cellular response to mycophenolic acid	ISS	biological process
GO:0005634	nucleus	ISS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05166	Human T-cell leukemia virus 1 infection
hsa04371	Apelin signaling pathway
hsa04928	Parathyroid hormone synthesis, secretion and action
hsa04912	GnRH signaling pathway
hsa04933	AGE-RAGE signaling pathway in diabetic complications
hsa05020	Prion diseases
P06959	CCKR signaling map

Diseases

Associated diseases	References
Myeloid neoplasm	PMID:17420284
Alzheimer's disease	PMID:21489990
pulmonary sarcoidosis	PMID:16933469
Breast cancer	PMID:9212230
Aortic valve stenosis	PMID:15597579
Squamous cell carcinoma	PMID:11948124
Arteriosclerosis	PMID:10712437
Asthma	PMID:18774390
Asthma	PMID:18507785
Chronic obstructive pulmonary disease	PMID:15469929
Osteosarcoma	PMID:21283769
Pulmonary fibrosis	PMID:19347046
lung non-small cell carcinoma	PMID:15774784
bronchiolo-alveolar adenocarcinoma	PMID:11948124
Pulmonary hypertension	PMID:20889906
Osteoarthritis	PMID:10806043
Pulmonary emphysema	PMID:11021835
Cryptorchidism	MIK: 28606200
Hypospadias	MIK: 24778562
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
24778562	Hypospadias			13 (5 controls, 8 cases)	Male infertility	Microarray