• Gene id: 1950

Gene Summary

• Gene Symbol: EGF   Gene   UCSC   Ensembl
• Aliases: HOMG4, URG
• Gene name: epidermal growth factor
• Alternate names: pro-epidermal growth factor, beta-urogastrone,
• Gene location: 4q25 (109912882: 110013078)     Exons: 26     NC_000004.12
• Gene summary(Entrez): This gene encodes a member of the epidermal growth factor superfamily. The encoded preproprotein is proteolytically processed to generate the 53-amino acid epidermal growth factor peptide. This protein acts a potent mitogenic factor that plays an importan
• OMIM: 131530

Protein Summary

• Protein general information: P01133  
  • Name: Pro epidermal growth factor (EGF) [Cleaved into: Epidermal growth factor (Urogastrone)]
  • Length: 1207  
  • Mass: 133,994
• Sequence:

  MLLTLIILLPVVSKFSFVSLSAPQHWSCPEGTLAGNGNSTCVGPAPFLIFSHGNSIFRIDTEGTNYEQLVVDAGV
  SVIMDFHYNEKRIYWVDLERQLLQRVFLNGSRQERVCNIEKNVSGMAINWINEEVIWSNQQEGIITVTDMKGNNS
  HILLSALKYPANVAVDPVERFIFWSSEVAGSLYRADLDGVGVKALLETSEKITAVSLDVLDKRLFWIQYNREGSN
  SLICSCDYDGGSVHISKHPTQHNLFAMSLFGDRIFYSTWKMKTIWIANKHTGKDMVRINLHSSFVPLGELKVVHP
  LAQPKAEDDTWEPEQKLCKLRKGNCSSTVCGQDLQSHLCMCAEGYALSRDRKYCEDVNECAFWNHGCTLGCKNTP
  GSYYCTCPVGFVLLPDGKRCHQLVSCPRNVSECSHDCVLTSEGPLCFCPEGSVLERDGKTCSGCSSPDNGGCSQL
  CVPLSPVSWECDCFPGYDLQLDEKSCAASGPQPFLLFANSQDIRHMHFDGTDYGTLLSQQMGMVYALDHDPVENK
  IYFAHTALKWIERANMDGSQRERLIEEGVDVPEGLAVDWIGRRFYWTDRGKSLIGRSDLNGKRSKIITKENISQP
  RGIAVHPMAKRLFWTDTGINPRIESSSLQGLGRLVIASSDLIWPSGITIDFLTDKLYWCDAKQSVIEMANLDGSK
  RRRLTQNDVGHPFAVAVFEDYVWFSDWAMPSVMRVNKRTGKDRVRLQGSMLKPSSLVVVHPLAKPGADPCLYQNG
  GCEHICKKRLGTAWCSCREGFMKASDGKTCLALDGHQLLAGGEVDLKNQVTPLDILSKTRVSEDNITESQHMLVA
  EIMVSDQDDCAPVGCSMYARCISEGEDATCQCLKGFAGDGKLCSDIDECEMGVPVCPPASSKCINTEGGYVCRCS
  EGYQGDGIHCLDIDECQLGEHSCGENASCTNTEGGYTCMCAGRLSEPGLICPDSTPPPHLREDDHHYSVRNSDSE
  CPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELRHAGHGQQQKVIVVAVCVVVLVMLLLLS
  LWGAHYYRTQKLLSKNPKNPYEESSRDVRSRRPADTEDGMSSCPQPWFVVIKEHQDLKNGGQPVAGEDGQAADGS
  MQPTSWRQEPQLCGMGTEQGCWIPVSSDKGSCPQVMERSFHMPSYGTQTLEGGVEKPHSLLSANPLWQQRALDPP
  HQMELTQ

• Structural information:
  • Protein Domains: EGF-like (314-355)
    EGF-like (356-396)
    ({ECO:0000255|PROSITE-ProRule:PRU00076}-)
    EGF-like (397-437)
    EGF-like (435-477)
  • Interpro: IPR011042  IPR001881  IPR013032  IPR000742  IPR000152   IPR018097  IPR009030  IPR000033  IPR016317  
  • Prosite: PS00010 PS00022 PS01186 PS50026 PS01187 PS51120
  • PDB: 1IVO 1JL9 1NQL 1P9J 2KV4 3NJP
  • PDBsum: 1IVO 1JL9 1NQL 1P9J 2KV4 3NJP
  • DIP: 5767
  • STRING: ENSP00000265171
• Other Databases: GeneCards:  EGF  Malacards:  EGF

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000165	MAPK cascade	TAS	biological process
GO:0000186	activation of MAPKK activity	IEA	biological process
GO:0000187	activation of MAPK activity	IEA	biological process
GO:0001525	angiogenesis	IDA	biological process
GO:0002576	platelet degranulation	TAS	biological process
GO:0004713	protein tyrosine kinase activity	EXP	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0005088	Ras guanyl-nucleotide exchange factor activity	TAS	molecular function
GO:0005154	epidermal growth factor receptor binding	TAS	molecular function
GO:0005154	epidermal growth factor receptor binding	TAS	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IC	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005765	lysosomal membrane	IDA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006260	DNA replication	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007171	activation of transmembrane receptor protein tyrosine kinase activity	IEA	biological process
GO:0007173	epidermal growth factor receptor signaling pathway	TAS	biological process
GO:0007262	STAT protein import into nucleus	ISS	biological process
GO:0008083	growth factor activity	IDA	molecular function
GO:0008083	growth factor activity	IDA	molecular function
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0010800	positive regulation of peptidyl-threonine phosphorylation	IDA	biological process
GO:0014066	regulation of phosphatidylinositol 3-kinase signaling	TAS	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0017147	Wnt-protein binding	IBA	molecular function
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0021940	positive regulation of cerebellar granule cell precursor proliferation	IEA	biological process
GO:0030297	transmembrane receptor protein tyrosine kinase activator activity	TAS	molecular function
GO:0031093	platelet alpha granule lumen	TAS	cellular component
GO:0035413	positive regulation of catenin import into nucleus	IDA	biological process
GO:0038128	ERBB2 signaling pathway	TAS	biological process
GO:0042059	negative regulation of epidermal growth factor receptor signaling pathway	TAS	biological process
GO:0042327	positive regulation of phosphorylation	IDA	biological process
GO:0042813	Wnt-activated receptor activity	IBA	molecular function
GO:0043235	receptor complex	IBA	cellular component
GO:0043388	positive regulation of DNA binding	ISS	biological process
GO:0043406	positive regulation of MAP kinase activity	IDA	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0044332	Wnt signaling pathway involved in dorsal/ventral axis specification	IBA	biological process
GO:0045741	positive regulation of epidermal growth factor-activated receptor activity	IDA	biological process
GO:0045741	positive regulation of epidermal growth factor-activated receptor activity	TAS	biological process
GO:0045840	positive regulation of mitotic nuclear division	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0046854	phosphatidylinositol phosphorylation	IEA	biological process
GO:0046934	phosphatidylinositol-4,5-bisphosphate 3-kinase activity	TAS	molecular function
GO:0048015	phosphatidylinositol-mediated signaling	TAS	biological process
GO:0048754	branching morphogenesis of an epithelial tube	IEA	biological process
GO:0051048	negative regulation of secretion	IDA	biological process
GO:0060070	canonical Wnt signaling pathway	IBA	biological process
GO:0060749	mammary gland alveolus development	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070371	ERK1 and ERK2 cascade	IDA	biological process
GO:0090279	regulation of calcium ion import	IDA	biological process
GO:0090370	negative regulation of cholesterol efflux	IEA	biological process
GO:1900127	positive regulation of hyaluronan biosynthetic process	IDA	biological process
GO:2000008	regulation of protein localization to cell surface	IDA	biological process
GO:2000060	positive regulation of protein ubiquitination involved in ubiquitin-dependent protein catabolic process	IEA	biological process
GO:2000145	regulation of cell motility	TAS	biological process
GO:0000165	MAPK cascade	TAS	biological process
GO:0000186	activation of MAPKK activity	IEA	biological process
GO:0000187	activation of MAPK activity	IEA	biological process
GO:0001525	angiogenesis	IDA	biological process
GO:0002576	platelet degranulation	TAS	biological process
GO:0004713	protein tyrosine kinase activity	EXP	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0005088	Ras guanyl-nucleotide exchange factor activity	TAS	molecular function
GO:0005154	epidermal growth factor receptor binding	IEA	molecular function
GO:0005154	epidermal growth factor receptor binding	TAS	molecular function
GO:0005154	epidermal growth factor receptor binding	TAS	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IC	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005765	lysosomal membrane	IDA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006260	DNA replication	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007171	activation of transmembrane receptor protein tyrosine kinase activity	IEA	biological process
GO:0007173	epidermal growth factor receptor signaling pathway	IEA	biological process
GO:0007173	epidermal growth factor receptor signaling pathway	TAS	biological process
GO:0007262	STAT protein import into nucleus	IEA	biological process
GO:0007262	STAT protein import into nucleus	ISS	biological process
GO:0008083	growth factor activity	IEA	molecular function
GO:0008083	growth factor activity	IDA	molecular function
GO:0008083	growth factor activity	IDA	molecular function
GO:0008284	positive regulation of cell proliferation	IEA	biological process
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0010800	positive regulation of peptidyl-threonine phosphorylation	IDA	biological process
GO:0014066	regulation of phosphatidylinositol 3-kinase signaling	TAS	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0017147	Wnt-protein binding	IBA	molecular function
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0021940	positive regulation of cerebellar granule cell precursor proliferation	IEA	biological process
GO:0030297	transmembrane receptor protein tyrosine kinase activator activity	TAS	molecular function
GO:0031093	platelet alpha granule lumen	TAS	cellular component
GO:0035413	positive regulation of catenin import into nucleus	IDA	biological process
GO:0038128	ERBB2 signaling pathway	TAS	biological process
GO:0042059	negative regulation of epidermal growth factor receptor signaling pathway	TAS	biological process
GO:0042327	positive regulation of phosphorylation	IDA	biological process
GO:0042813	Wnt-activated receptor activity	IBA	molecular function
GO:0043235	receptor complex	IBA	cellular component
GO:0043388	positive regulation of DNA binding	IEA	biological process
GO:0043388	positive regulation of DNA binding	ISS	biological process
GO:0043406	positive regulation of MAP kinase activity	IDA	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0044332	Wnt signaling pathway involved in dorsal/ventral axis specification	IBA	biological process
GO:0045741	positive regulation of epidermal growth factor-activated receptor activity	IDA	biological process
GO:0045741	positive regulation of epidermal growth factor-activated receptor activity	TAS	biological process
GO:0045840	positive regulation of mitotic nuclear division	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0046854	phosphatidylinositol phosphorylation	IEA	biological process
GO:0046934	phosphatidylinositol-4,5-bisphosphate 3-kinase activity	TAS	molecular function
GO:0048015	phosphatidylinositol-mediated signaling	TAS	biological process
GO:0048754	branching morphogenesis of an epithelial tube	IEA	biological process
GO:0050730	regulation of peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0051048	negative regulation of secretion	IDA	biological process
GO:0060070	canonical Wnt signaling pathway	IBA	biological process
GO:0060749	mammary gland alveolus development	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070371	ERK1 and ERK2 cascade	IDA	biological process
GO:0090279	regulation of calcium ion import	IDA	biological process
GO:0090370	negative regulation of cholesterol efflux	IEA	biological process
GO:1900127	positive regulation of hyaluronan biosynthetic process	IDA	biological process
GO:2000008	regulation of protein localization to cell surface	IDA	biological process
GO:2000060	positive regulation of protein ubiquitination involved in ubiquitin-dependent protein catabolic process	IEA	biological process
GO:2000145	regulation of cell motility	TAS	biological process
GO:0000165	MAPK cascade	TAS	biological process
GO:0001525	angiogenesis	IDA	biological process
GO:0002576	platelet degranulation	TAS	biological process
GO:0004713	protein tyrosine kinase activity	EXP	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0005088	Ras guanyl-nucleotide exchange factor activity	TAS	molecular function
GO:0005154	epidermal growth factor receptor binding	TAS	molecular function
GO:0005154	epidermal growth factor receptor binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IC	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005765	lysosomal membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006260	DNA replication	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007173	epidermal growth factor receptor signaling pathway	TAS	biological process
GO:0007262	STAT protein import into nucleus	ISS	biological process
GO:0008083	growth factor activity	IDA	molecular function
GO:0008083	growth factor activity	IDA	molecular function
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0010800	positive regulation of peptidyl-threonine phosphorylation	IDA	biological process
GO:0014066	regulation of phosphatidylinositol 3-kinase signaling	TAS	biological process
GO:0017147	Wnt-protein binding	IBA	molecular function
GO:0030297	transmembrane receptor protein tyrosine kinase activator activity	TAS	molecular function
GO:0031093	platelet alpha granule lumen	TAS	cellular component
GO:0035413	positive regulation of catenin import into nucleus	IDA	biological process
GO:0038128	ERBB2 signaling pathway	TAS	biological process
GO:0042059	negative regulation of epidermal growth factor receptor signaling pathway	TAS	biological process
GO:0042327	positive regulation of phosphorylation	IDA	biological process
GO:0042813	Wnt-activated receptor activity	IBA	molecular function
GO:0043235	receptor complex	IBA	cellular component
GO:0043388	positive regulation of DNA binding	ISS	biological process
GO:0043406	positive regulation of MAP kinase activity	IDA	biological process
GO:0044332	Wnt signaling pathway involved in dorsal/ventral axis specification	IBA	biological process
GO:0045741	positive regulation of epidermal growth factor-activated receptor activity	IDA	biological process
GO:0045741	positive regulation of epidermal growth factor-activated receptor activity	TAS	biological process
GO:0045840	positive regulation of mitotic nuclear division	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0046934	phosphatidylinositol-4,5-bisphosphate 3-kinase activity	TAS	molecular function
GO:0048015	phosphatidylinositol-mediated signaling	TAS	biological process
GO:0051048	negative regulation of secretion	IDA	biological process
GO:0060070	canonical Wnt signaling pathway	IBA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070371	ERK1 and ERK2 cascade	IDA	biological process
GO:0090279	regulation of calcium ion import	IDA	biological process
GO:1900127	positive regulation of hyaluronan biosynthetic process	IDA	biological process
GO:2000008	regulation of protein localization to cell surface	IDA	biological process
GO:2000145	regulation of cell motility	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04066	HIF-1 signaling pathway
hsa04068	FoxO signaling pathway
hsa04072	Phospholipase D signaling pathway
hsa04151	PI3K-Akt signaling pathway
hsa04510	Focal adhesion
hsa04540	Gap junction
hsa04810	Regulation of actin cytoskeleton
hsa05200	Pathways in cancer
hsa05231	Choline metabolism in cancer
hsa05235	PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05210	Colorectal cancer
hsa05212	Pancreatic cancer
hsa05226	Gastric cancer
hsa05214	Glioma
hsa05218	Melanoma
hsa05219	Bladder cancer
hsa05215	Prostate cancer
hsa05213	Endometrial cancer
hsa05224	Breast cancer
hsa05223	Non-small cell lung cancer
hsa05160	Hepatitis C
hsa05165	Human papillomavirus infection
hsa01521	EGFR tyrosine kinase inhibitor resistance

Diseases

Associated diseases	References
Cancer	GAD: 19900104
Cancer (Adenocarcinoma)	GAD: 18483390
Cancer (Hepatocellular)	GAD: 19817957
Cancer (leukemia)	GAD: 19074885
Cancer (lung)	GAD: 15663953
Cancer (melanoma)	GAD: 11844511
Cancer (ovarian)	GAD: 20628624
Cancer (prostate)	GAD: 18519765
Cancer (rectal)	GAD: 17661145
Cancer (Renal cell)	GAD: 20203692
Cancer (Squamous cell)	GAD: 18722874
Cancer (stomach)	GAD: 16214932
Cancer (bladder)	GAD: 19692168
Cancer (brain)	GAD: 16885506
Cancer (cervical)	GAD: 17316357
Cancer (colorectal)	GAD: 18349392
Cancer (epithelial ovarian)	GAD: 19064572
Cancer (esophageal)	GAD: 20453000
Cancer (glioblastoma)	GAD: 14973082
Cancer (glioma)	GAD: 20108217
Cancer (pancreatic)	GAD: 21187523
Cancer (gastric)	KEGG: H00018
Cancer (breast)	GAD: 19124506
Cardiovascular disease	GAD: 18382118
Hypertension	GAD: 12009575
Cardiovascular disease	GAD: 12009575
Cleft defects	GAD: 20634891
Hyperparathyroidism	GAD: 20424473
Periodontitis	GAD: 15081423
Psoriatic arthritis	GAD: 17204151
Diabetes	GAD: 17479438
Bone diseases	GAD: 19453261
Psychological disorders	GAD: 19086053
Schizophrenia	GAD: 16115648
Several psychiatric disorders	GAD: 19086053
Chronic renal failure	GAD: 21085059
Abortion	GAD: 20587610
Preeclampsia	GAD: 19708171
Adenomyosis	INFBASE: 12069392
Female infertility	INFBASE: 12069392
Oocyte maturation	INFBASE: 22532606
Polycystic ovary syndrome (PCOS)	INFBASE: 8654631
Cryptorchidism	MIK: 12508124
Cryptorchidism	MIK: 12508124
Male factor infertility	MIK: 12508124
Prostatic function	MIK: 1503528
Prostatitis	MIK: 1503528
Endometriosis	INFBASE: 27128987
Female infertility	INFBASE: 17578349
Chronic obstructive pulmonary disease (COPD)	GAD: 19625176
Respiratory distress syndrome	GAD: 19010984
Hypomagnesemia	OMIM: 131530
Cryptorchidism	MIK: 12508124
Cryptorchidism	MIK: 12508124
Cryptorchidism	MIK: 28606200
Male infertility	MIK: 11379442
Male infertility	MIK: 6601587
Prostatic function	MIK: 1503528
Prostatitis	MIK: 1503528
Stimulates mouse sperm capacitation	MIK: 8258731

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
12508124	cryptorchid boys				Male infertility	EGFR
6601587	Male infertility			62 (20 normal men, 42 patients with infertility)	Male infertility
12508124	Cryptorchid				Male infertility	EGF EGFR
11379442	Male infertility			70 (39 fertile men, 31 infertile men)	Male infertility
1503528	Prostatic function				Male infertility
1503528	Prostatitis				Male infertility	EGF
11379442	Male infertility			70 (39 fertile men, 31 infertile men)	Male infertility	EGF LH FSH prolactin
8258731	Stimulates mouse sperm capacitation				Male infertility	EGF
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq