• Gene id: 1949

Gene Summary

• Gene Symbol: EFNB3   Gene   UCSC   Ensembl
• Aliases: EFL6, EPLG8, LERK8
• Gene name: ephrin B3
• Alternate names: ephrin-B3, EPH-related receptor transmembrane ligand ELK-L3, eph-related receptor tyrosine kinase ligand 8,
• Gene location: 17p13.1 (7705201: 7711371)     Exons: 5     NC_000017.11
• Gene summary(Entrez): EFNB3, a member of the ephrin gene family, is important in brain development as well as in its maintenance. Moreover, since levels of EFNB3 expression were particularly high in several forebrain subregions compared to other brain subregions, it may play

Protein Summary

• Protein general information: Q15768  
  • Name: Ephrin B3 (EPH related receptor transmembrane ligand ELK L3) (EPH related receptor tyrosine kinase ligand 8) (LERK 8)
  • Length: 340  
  • Mass: 35835
  • Tissue specificity: Highly expressed in brain; expressed in embryonic floor plate, roof plate and hindbrain segments.
• Sequence:

  MGPPHSGPGGVRVGALLLLGVLGLVSGLSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDLLCPRARPPGPHSSPN
  YEFYKLYLVGGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIATSDGTREGLES
  LQGGVCLTRGMKVLLRVGQSPRGGAVPRKPVSEMPMERDRGAAHSLEPGKENLPGDPTSNATSRGAEGPLPPPSM
  PAVAGAAGGLALLLLGVAGAGGAMCWRRRRAKPSESRHPGPGSFGRGGSLGLGGGGGMGPREAEPGELGIALRGG
  GAADPPFCPHYEKVSGDYGHPVYIVQDGPPQSPPNIYYKV

• Structural information:
  • Protein Domains: (28..16-)
    (/note="Ephrin-RBD)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00884"-)
  • Interpro: IPR008972  IPR031328  IPR019765  IPR001799  
  • Prosite: PS01299 PS51551
  • PDB: 4BKF
  • PDBsum: 4BKF
  • DIP: 59196
  • STRING: ENSP00000226091
• Other Databases: GeneCards:  EFNB3  Malacards:  EFNB3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050771	negative regulation of axonogenesis	ISS	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0007411	axon guidance	IBA	biological process
GO:0099056	integral component of presynaptic membrane	IBA	cellular component
GO:0046875	ephrin receptor binding	IBA	molecular function
GO:0048013	ephrin receptor signaling pathway	IBA	biological process
GO:0098978	glutamatergic synapse	IBA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0001618	virus receptor activity	IEA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0007399	nervous system development	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005005	transmembrane-ephrin receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007399	nervous system development	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0048013	ephrin receptor signaling pathway	IDA	biological process
GO:0046875	ephrin receptor binding	IDA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0048013	ephrin receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0050771	negative regulation of axonogenesis	IEA	biological process
GO:0031295	T cell costimulation	IEA	biological process
GO:0099061	integral component of postsynaptic density membrane	IEA	cellular component
GO:0099557	trans-synaptic signaling by trans-synaptic complex, modulating synaptic transmission	IEA	biological process
GO:0099056	integral component of presynaptic membrane	IEA	cellular component
GO:0098686	hippocampal mossy fiber to CA3 synapse	IEA	cellular component
GO:0016198	axon choice point recognition	IEA	biological process
GO:0007628	adult walking behavior	IEA	biological process
GO:0007411	axon guidance	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0046718	viral entry into host cell	IEA	biological process
GO:0005886	plasma membrane	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04360	Axon guidance

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq