• Gene id: 1948

Gene Summary

• Gene Symbol: EFNB2   Gene   UCSC   Ensembl
• Aliases: EPLG5, HTKL, Htk-L, LERK5
• Gene name: ephrin B2
• Alternate names: ephrin-B2, HTK ligand, eph-related receptor tyrosine kinase ligand 5, ligand of eph-related kinase 5,
• Gene location: 13q33.3 (106535661: 106489744)     Exons: 7     NC_000013.11
• Gene summary(Entrez): This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system a

Protein Summary

• Protein general information: P52799  
  • Name: Ephrin B2 (EPH related receptor tyrosine kinase ligand 5) (LERK 5) (HTK ligand) (HTK L)
  • Length: 333  
  • Mass: 36923
  • Tissue specificity: Lung and kidney.
• Sequence:

  MAVRRDSVWKYCWGVLMVLCRTAISKSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEY
  YKVYMVDKDQADRCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEG
  GVCQTRAMKILMKVGQDASSAGSTRNKDPTRRPELEAGTNGRSSTTSPFVKPNPGSSTDGNSAGHSGNNILGSEV
  ALFAGIASGCIIFIVIIITLVVLLLKYRRRHRKHSPQHTTTLSLSTLATPKRSGNNNGSEPSDIIIPLRTADSVF
  CPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV

• Structural information:
  • Protein Domains: (28..16-)
    (/note="Ephrin-RBD)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00884"-)
  • Interpro: IPR008972  IPR031328  IPR034255  IPR019765  IPR001799  
  • Prosite: PS01299 PS51551
  • CDD: cd10426
  • PDB: 2HLE 2I85 2VSK 2VSM 2WO2 3GXU 4UF7 6P7Y 6PDL
  • PDBsum: 2HLE 2I85 2VSK 2VSM 2WO2 3GXU 4UF7 6P7Y 6PDL
  • DIP: 46378
  • STRING: ENSP00000245323
• Other Databases: GeneCards:  EFNB2  Malacards:  EFNB2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1901216	positive regulation of neuron death	IDA	biological process
GO:0010977	negative regulation of neuron projection development	IDA	biological process
GO:0046875	ephrin receptor binding	IBA	molecular function
GO:0048013	ephrin receptor signaling pathway	IBA	biological process
GO:0048514	blood vessel morphogenesis	IBA	biological process
GO:0098978	glutamatergic synapse	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0007411	axon guidance	IBA	biological process
GO:0099056	integral component of presynaptic membrane	IBA	cellular component
GO:0048013	ephrin receptor signaling pathway	IDA	biological process
GO:0050920	regulation of chemotaxis	IDA	biological process
GO:0007155	cell adhesion	IDA	biological process
GO:0002042	cell migration involved in sprouting angiogenesis	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0046875	ephrin receptor binding	IPI	molecular function
GO:0046875	ephrin receptor binding	IEA	molecular function
GO:0048013	ephrin receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0001618	virus receptor activity	IEA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0001525	angiogenesis	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0046875	ephrin receptor binding	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007267	cell-cell signaling	TAS	biological process
GO:0009653	anatomical structure morphogenesis	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0048013	ephrin receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0099054	presynapse assembly	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:2000727	positive regulation of cardiac muscle cell differentiation	IEA	biological process
GO:1903849	positive regulation of aorta morphogenesis	IEA	biological process
GO:0099149	regulation of postsynaptic neurotransmitter receptor internalization	IEA	biological process
GO:0099072	regulation of postsynaptic membrane neurotransmitter receptor levels	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0098685	Schaffer collateral - CA1 synapse	IEA	cellular component
GO:0072178	nephric duct morphogenesis	IEA	biological process
GO:0048845	venous blood vessel morphogenesis	IEA	biological process
GO:0048514	blood vessel morphogenesis	IEA	biological process
GO:0034332	adherens junction organization	IEA	biological process
GO:0031295	T cell costimulation	IEA	biological process
GO:0010839	negative regulation of keratinocyte proliferation	IEA	biological process
GO:0009887	animal organ morphogenesis	IEA	biological process
GO:0099056	integral component of presynaptic membrane	IEA	cellular component
GO:0099061	integral component of postsynaptic density membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0001945	lymph vessel development	IEA	biological process
GO:2000727	positive regulation of cardiac muscle cell differentiation	ISS	biological process
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:0005912	adherens junction	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0046718	viral entry into host cell	IEA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005925	focal adhesion	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04360	Axon guidance

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq