• Gene id: 1944

Gene Summary

• Gene Symbol: EFNA3   Gene   UCSC   Ensembl
• Aliases: EFL2, EPLG3, Ehk1-L, LERK3
• Gene name: ephrin A3
• Alternate names: ephrin-A3, EFL-2, EHK1 ligand, LERK-3, eph-related receptor tyrosine kinase ligand 3, ligand of eph-related kinase 3,
• Gene location: 1q21.3 (230745607: 230716764)     Exons: 9     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system a

Protein Summary

• Protein general information: P52797  
  • Name: Ephrin A3 (EFL 2) (EHK1 ligand) (EHK1 L) (EPH related receptor tyrosine kinase ligand 3) (LERK 3)
  • Length: 238  
  • Mass: 26350
  • Tissue specificity: Expressed in brain, skeletal muscle, spleen, thymus, prostate, testis, ovary, small intestine, and peripheral blood leukocytes.
• Sequence:

  MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGA
  GPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYYYISTP
  THNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSISGTSPKREHLPLA
  VGIAFFLMTFLAS

• Structural information:
  • Protein Domains: (30..16-)
    (/note="Ephrin-RBD)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00884"-)
  • Interpro: IPR008972  IPR031328  IPR034252  IPR019765  IPR001799  
  • Prosite: PS01299 PS51551
  • CDD: cd10425
  • STRING: ENSP00000357393
• Other Databases: GeneCards:  EFNA3  Malacards:  EFNA3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1902961	positive regulation of aspartic-type endopeptidase activity involved in amyloid precursor protein catabolic process	IGI	biological process
GO:0048013	ephrin receptor signaling pathway	IGI	biological process
GO:0005886	plasma membrane	NAS	cellular component
GO:0046875	ephrin receptor binding	IBA	molecular function
GO:0048013	ephrin receptor signaling pathway	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0007411	axon guidance	IBA	biological process
GO:0048013	ephrin receptor signaling pathway	ISS	biological process
GO:0031226	intrinsic component of plasma membrane	TAS	cellular component
GO:0046875	ephrin receptor binding	IEA	molecular function
GO:0048013	ephrin receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005005	transmembrane-ephrin receptor activity	TAS	molecular function
GO:0007267	cell-cell signaling	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0048013	ephrin receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048013	ephrin receptor signaling pathway	IEA	biological process
GO:0046875	ephrin receptor binding	IEA	molecular function
GO:0045664	regulation of neuron differentiation	IEA	biological process
GO:0016525	negative regulation of angiogenesis	IDA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0046875	ephrin receptor binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa04010	MAPK signaling pathway
hsa05206	MicroRNAs in cancer
hsa04014	Ras signaling pathway
hsa04015	Rap1 signaling pathway
hsa04360	Axon guidance

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq