• Gene id: 1942

Gene Summary

• Gene Symbol: EFNA1   Gene   UCSC   Ensembl
• Aliases: B61, ECKLG, EFL1, EPLG1, GMAN, LERK-1, LERK1, TNFAIP4
• Gene name: ephrin A1
• Alternate names: ephrin-A1, TNF alpha-induced protein 4, eph-related receptor tyrosine kinase ligand 1, epididymis secretory sperm binding protein, gastric cancer metastasis associated long noncoding RNA, immediate early response protein B61, ligand of eph-related kinase 1, tumo,
• Gene location: 1q22 (70404144: 70428617)     Exons: 3     NC_000010.11
• Gene summary(Entrez): This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system a
• OMIM: 191164

Protein Summary

• Protein general information: P20827  
  • Name: Ephrin A1 (EPH related receptor tyrosine kinase ligand 1) (LERK 1) (Immediate early response protein B61) (Tumor necrosis factor alpha induced protein 4) (TNF alpha induced protein 4) [Cleaved into: Ephrin A1, secreted form]
  • Length: 205  
  • Mass: 23787
  • Tissue specificity: Brain. Down-regulated in primary glioma tissues compared to the normal tissues. The soluble monomeric form is expressed in the glioblastoma multiforme (GBM) and breast cancer cells (at protein level). {ECO
• Sequence:

  MEFLWAPLLGLCCSLAAADRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHE
  EYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSGK
  ITHSPQAHDNPQEKRLAADDPEVRVLHSIGHSAAPRLFPLAWTVLLLPLLLLQTP

• Structural information:
  • Protein Domains: (19..15-)
    (/note="Ephrin-RBD)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00884"-)
  • Interpro: IPR008972  IPR031328  IPR034252  IPR019765  IPR001799  
  • Prosite: PS01299 PS51551
  • CDD: cd10425
  • PDB: 3CZU 3HEI 3MBW
  • PDBsum: 3CZU 3HEI 3MBW
  • DIP: 98
  • STRING: ENSP00000357392
• Other Databases: GeneCards:  EFNA1  Malacards:  EFNA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1902004	positive regulation of amyloid-beta formation	IDA	biological process
GO:1902961	positive regulation of aspartic-type endopeptidase activity involved in amyloid precursor protein catabolic process	IGI	biological process
GO:1903051	negative regulation of proteolysis involved in cellular protein catabolic process	IGI	biological process
GO:0048013	ephrin receptor signaling pathway	IGI	biological process
GO:0005886	plasma membrane	NAS	cellular component
GO:0050821	protein stabilization	IGI	biological process
GO:0001934	positive regulation of protein phosphorylation	IGI	biological process
GO:0001934	positive regulation of protein phosphorylation	IGI	biological process
GO:0061098	positive regulation of protein tyrosine kinase activity	IGI	biological process
GO:0048013	ephrin receptor signaling pathway	IBA	biological process
GO:0046875	ephrin receptor binding	IBA	molecular function
GO:0046658	anchored component of plasma membrane	IBA	cellular component
GO:0007411	axon guidance	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0048013	ephrin receptor signaling pathway	IDA	biological process
GO:0016477	cell migration	IDA	biological process
GO:0034446	substrate adhesion-dependent cell spreading	IDA	biological process
GO:0033628	regulation of cell adhesion mediated by integrin	IDA	biological process
GO:0061002	negative regulation of dendritic spine morphogenesis	ISS	biological process
GO:0050730	regulation of peptidyl-tyrosine phosphorylation	ISS	biological process
GO:0046875	ephrin receptor binding	IEA	molecular function
GO:0048013	ephrin receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0001525	angiogenesis	IEA	biological process
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0046875	ephrin receptor binding	TAS	molecular function
GO:0007267	cell-cell signaling	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0048013	ephrin receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003183	mitral valve morphogenesis	IEA	biological process
GO:0003199	endocardial cushion to mesenchymal transition involved in heart valve formation	IEA	biological process
GO:0010719	negative regulation of epithelial to mesenchymal transition	IEA	biological process
GO:0046658	anchored component of plasma membrane	IEA	cellular component
GO:0048013	ephrin receptor signaling pathway	IEA	biological process
GO:0050770	regulation of axonogenesis	IEA	biological process
GO:0061002	negative regulation of dendritic spine morphogenesis	IEA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0003180	aortic valve morphogenesis	IEA	biological process
GO:0014028	notochord formation	IEA	biological process
GO:0030182	neuron differentiation	IEA	biological process
GO:0043409	negative regulation of MAPK cascade	IEA	biological process
GO:0043410	positive regulation of MAPK cascade	IEA	biological process
GO:0043535	regulation of blood vessel endothelial cell migration	IEA	biological process
GO:0045765	regulation of angiogenesis	IEA	biological process
GO:0050730	regulation of peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0070244	negative regulation of thymocyte apoptotic process	IEA	biological process
GO:0003183	mitral valve morphogenesis	ISS	biological process
GO:0003199	endocardial cushion to mesenchymal transition involved in heart valve formation	ISS	biological process
GO:0010719	negative regulation of epithelial to mesenchymal transition	ISS	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	ISS	biological process
GO:0003180	aortic valve morphogenesis	ISS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0046875	ephrin receptor binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa04010	MAPK signaling pathway
hsa05206	MicroRNAs in cancer
hsa04014	Ras signaling pathway
hsa04015	Rap1 signaling pathway
hsa04360	Axon guidance

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray