• Gene id: 1938

Gene Summary

• Gene Symbol: EEF2   Gene   UCSC   Ensembl
• Aliases: EEF-2, EF-2, EF2, SCA26
• Gene name: eukaryotic translation elongation factor 2
• Alternate names: elongation factor 2, epididymis secretory sperm binding protein, polypeptidyl-tRNA translocase,
• Gene location: 19p13.3 (31373617: 31359594)     Exons: 5     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the GTP-binding translation elongation factor family. This protein is an essential factor for protein synthesis. It promotes the GTP-dependent translocation of the nascent protein chain from the A-site to the P-site of the ri
• OMIM: 130610

Protein Summary

• Protein general information: P13639  
  • Name: Elongation factor 2 (EF 2)
  • Length: 858  
  • Mass: 95338
• Sequence:

  MVNFTVDQIRAIMDKKANIRNMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTRKDEQERCITIKSTAI
  SLFYELSENDLNFIKQSKDGAGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAER
  IKPVLMMNKMDRALLELQLEPEELYQTFQRIVENVNVIISTYGEGESGPMGNIMIDPVLGTVGFGSGLHGWAFTL
  KQFAEMYVAKFAAKGEGQLGPAERAKKVEDMMKKLWGDRYFDPANGKFSKSATSPEGKKLPRTFCQLILDPIFKV
  FDAIMNFKKEETAKLIEKLDIKLDSEDKDKEGKPLLKAVMRRWLPAGDALLQMITIHLPSPVTAQKYRCELLYEG
  PPDDEAAMGIKSCDPKGPLMMYISKMVPTSDKGRFYAFGRVFSGLVSTGLKVRIMGPNYTPGKKEDLYLKPIQRT
  ILMMGRYVEPIEDVPCGNIVGLVGVDQFLVKTGTITTFEHAHNMRVMKFSVSPVVRVAVEAKNPADLPKLVEGLK
  RLAKSDPMVQCIIEESGEHIIAGAGELHLEICLKDLEEDHACIPIKKSDPVVSYRETVSEESNVLCLSKSPNKHN
  RLYMKARPFPDGLAEDIDKGEVSARQELKQRARYLAEKYEWDVAEARKIWCFGPDGTGPNILTDITKGVQYLNEI
  KDSVVAGFQWATKEGALCEENMRGVRFDVHDVTLHADAIHRGGGQIIPTARRCLYASVLTAQPRLMEPIYLVEIQ
  CPEQVVGGIYGVLNRKRGHVFEESQVAGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPF
  DNSSRPSQVVAETRKRKGLKEGIPALDNFLDKL

• Structural information:
  • Protein Domains: (17..36-)
    (/note="tr-type-G)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01059"-)
  • Interpro: IPR041095  IPR035647  IPR000640  IPR004161  IPR031157   IPR027417  IPR020568  IPR014721  IPR005225  IPR000795  IPR009000  IPR005517  
  • Prosite: PS00301 PS51722
  • PDB: 4V6X 6D9J
  • PDBsum: 4V6X 6D9J
  • STRING: ENSP00000307940
• Other Databases: GeneCards:  EEF2  Malacards:  EEF2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1990904	ribonucleoprotein complex	IBA	cellular component
GO:0043022	ribosome binding	IBA	molecular function
GO:0006414	translational elongation	IBA	biological process
GO:0003924	GTPase activity	IBA	molecular function
GO:0003746	translation elongation factor activity	IBA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0003746	translation elongation factor activity	IEA	molecular function
GO:0006414	translational elongation	IEA	biological process
GO:0006412	translation	IEA	biological process
GO:0005525	GTP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:1990904	ribonucleoprotein complex	IDA	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:1904813	ficolin-1-rich granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006414	translational elongation	TAS	biological process
GO:0034774	secretory granule lumen	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002039	p53 binding	IEA	molecular function
GO:0002931	response to ischemia	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0007568	aging	IEA	biological process
GO:0014009	glial cell proliferation	IEA	biological process
GO:0032355	response to estradiol	IEA	biological process
GO:0043022	ribosome binding	IEA	molecular function
GO:0045121	membrane raft	IEA	cellular component
GO:0045471	response to ethanol	IEA	biological process
GO:0045727	positive regulation of translation	IEA	biological process
GO:0051015	actin filament binding	IEA	molecular function
GO:0051593	response to folic acid	IEA	biological process
GO:1990416	cellular response to brain-derived neurotrophic factor stimulus	IEA	biological process
GO:1990904	ribonucleoprotein complex	IEA	cellular component
GO:2000767	positive regulation of cytoplasmic translation	IEA	biological process
GO:0003924	GTPase activity	IEA	molecular function
GO:0006414	translational elongation	IEA	biological process
GO:0003009	skeletal muscle contraction	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0008097	5S rRNA binding	IEA	molecular function
GO:0034976	response to endoplasmic reticulum stress	IEA	biological process
GO:0035914	skeletal muscle cell differentiation	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0042542	response to hydrogen peroxide	IEA	biological process
GO:0042788	polysomal ribosome	IEA	cellular component
GO:0002244	hematopoietic progenitor cell differentiation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005844	polysome	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0045296	cadherin binding	HDA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016235	aggresome	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005634	nucleus	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0045727	positive regulation of translation	IMP	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0016020	membrane	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04921	Oxytocin signaling pathway
hsa04152	AMPK signaling pathway

Diseases

Associated diseases	References
Spinocerebellar ataxia	KEGG:H00063
Spinocerebellar ataxia	KEGG:H00063
Alzheimer's disease	PMID:1331687
Glaucoma	PMID:20107165
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881