• Gene id: 1937

Gene Summary

• Gene Symbol: EEF1G   Gene   UCSC   Ensembl
• Aliases: EF1G, GIG35
• Gene name: eukaryotic translation elongation factor 1 gamma
• Alternate names: elongation factor 1-gamma, EF-1-gamma, PRO1608, eEF-1B gamma, pancreatic tumor-related protein, translation elongation factor eEF-1 gamma chain,
• Gene location: 11q12.3 (62573890: 62559595)     Exons: 10     NC_000011.10
• Gene summary(Entrez): This gene encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit contains an N-terminal glutathione transferase domain, which may be involved in regulating the
• OMIM: 130593

Protein Summary

• Protein general information: P26641  
  • Name: Elongation factor 1 gamma (EF 1 gamma) (eEF 1B gamma)
  • Length: 437  
  • Mass: 50119
  • Tissue specificity: Highly expressed in pancreatic tumor tissue and to a lesser extent in normal kidney, intestine, pancreas, stomach, lung, brain, spleen and liver.
• Sequence:

  MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAI
  AYYVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNKQATENAKEEVRRILGLLDAYLKTRT
  FLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAETQ
  PKKDTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKRKYSNE
  DTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVW
  VFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQGKIFK

• Structural information:
  • Protein Domains: (2..8-)
    (/note="GST-N-terminal)
    (88..21-)
    (/note="GST-C-terminal)
    (276..43-)
    (/note="EF-1-gamma-C-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00519"-)
  • Interpro: IPR001662  IPR036433  IPR010987  IPR036282  IPR040079   IPR004045  IPR004046  IPR036249  
  • Prosite: PS50040 PS50405 PS50404
  • PDB: 1PBU 5DQS 5JPO
  • PDBsum: 1PBU 5DQS 5JPO
  • DIP: 32516
  • STRING: ENSP00000331901
• Other Databases: GeneCards:  EEF1G  Malacards:  EEF1G

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006414	translational elongation	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0003746	translation elongation factor activity	IEA	molecular function
GO:0006414	translational elongation	IEA	biological process
GO:0006412	translation	IEA	biological process
GO:0003746	translation elongation factor activity	IEA	molecular function
GO:0006414	translational elongation	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006414	translational elongation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045296	cadherin binding	HDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	colocalizes with
GO:0005737	cytoplasm	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005634	nucleus	HDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0009615	response to virus	IEP	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05134	Legionellosis

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq